Miller, G.A., (1979). Images and models, similes and metaphors. In A. Ortonyed, Metaphor and thought. Cambridge: Cambr. UP.       

Bruner, J.S., (1978). The role of dialogue in language acquisition. New York: Springer-Verlag.

von Humboldt, W., (1991). History of linguistics. Kondrashov N.A. Trans. Moscow, pp: 192.

Kroeber, A.L., (1943). Franz Boas: The Man. American Anthropological Association. Memoirs, 61: 5-26.

Edward, S., (1949). Selected writings in language, culture and personality. Berkeley.

Whorf, B.L., (1956). Language, Thought, and Reality. THE M.I.T. PRESS. ISBN: 0-262-73006-5.

Shchedrovsky, G.P. and M.V. Rozin, (1967). The conception of B.L. Whorf’s linguistic relativity and problems of studying “linguistic thinking”. Semiotics and Oriental languages. Moscow, pp: 225.

Lakoff, G., 1(982). Categories: An essay in cognitive linguistics. LiMed. Linguistics in the morning calm: Selected papers from the SICOL-1981. Seoul: Hanship, pp: 139-193.

Lakoff, G., (1980). Metaphors we live by G. Lakoff & M. Johnson. Originally published: University of Chicago Press. Date Views 28.05.2016 http://shu.bg/tadmin/upload/storage/161.pdf.

Teun, A. van Dijk, (1985). Discourse and communication. Berlin/New York: de Gruyter.

Weisgerber, L., (1993). Mother tongue and education of mind. Мoscow, 1993, pp: 380.

Harman, G., (1988). Cognitive science. The making of cognitive Science: Essays in honour of George Miller. Ed.by W. Hirst. Cambridge, pp: 43.

Maslova, V.A., (2004). Cognitive linguistics. Minsk: Tetra Sistems, pp: 80.

Dubois, D. and P. Resche-Rigon, (1995). De la naturalitee des categories semantiquesː res categories dˈobjets naturels aux categories lexicales. Intellectia, pp: 20-247.

Rastier, F., (1993). La semantique cognitive et lˈespace, Images et Langages: Multimodalite et modelisation cognitive. Parisː CNRS, pp: 173-185.

Latin-Russian dictionary, (1976). Moscow, pp: 222.

Atasoy, E., & Ertürk, H. (2008). A field study about environmental knowledge and attitudes of elementary scool students. Journal of Education Faculty, 10 (1), 105-122.

Bagner, D. M., Storch, E. A., & Roberti, J. W. (2004). A Factor analytic study of the loneliness and social dissatisfaction scale in a sample of african-american and hispanic-american children. Child Psychiatry and Human Development, 34(3), 237-250.

Bamberg, S., & Moser, G. (2007). Twenty years after Hines, Hungerford and Tomera: A new meta-analysis of psycho-social determinants of pro-environmental behavior. Journal of Environmental Psychology, 27, 14-25.

Benzer, E., & Şahin F. (2012). Evaluation of preservice science teachers’ environmental literacy by using case studies throughout project based learning. Marmara University Journal of Educational Sciences, 35, 55-83

Bogner, F.X., & Wiseman, M. (1997). Environmental perception of urban and rural pupils. Journal of Environmental Psychology, 17, 111-122.

Brody, S.D., & H.C. Ryu.(2006). Measuring the educational impacts of a graduate course on sustainable development. Environmental Education Research 12(2), 179–99.

Büyüköztürk, Ş.,Bökeoğlu, Ö. Ç., & Köklü, N. (2008). Statistics for social sciences (3. Edition). Ankara: Pegem A Academy.

Çetin, B., Doğan, T., & Sapmaz, F. (2010). The turkish adaptation of brief fear of negative evaluation scale: the validity and reliability study. Education and Science, 35(156): 205-216

Cetin-Dindar, A., & Geban, O. (2015). Adaptation of the Science Motivation Scale into Turkish and Chemistry: Analysis of Validity. Pegem Journal of Education and Instruction, 5(1), 19-38.

Cottrell, S.P., & Graefe, A.R. (1997). Testing a conceptual framework of responsible environmental behavior. The Journal of Environmental Education, 29(1), 17-27.

Disinger, J.F., & Roth, R.E. (1992). Environmental literacy. Columbus, OH: ERIC Clearinghouse for Science, Mathematics and Environmental education, ED351201.

Dresner, M.G., & Gill, M. (1994). Environmental education at summer nature camp. Journal of Environmental Education, 25(3), 35-41.

Erdoğan, E., Kostava, Z., & Marcinkowski,T. (2009). Components of environmental literacy in elementary science education curriculum in Bulgaria and Turkey, Eurasia Journal of Mathematics, Science & Technology, 5(1), 15-26.

Erdogan, M., & Marcinkowski, T. (2015). Development and Validation of Children’s Environmental Affect (Attitude, Sensitivity and Willingness to take action) Scale. Eurasia Journal of Mathematics, Science & Technology Education, 11(3) 577-588.

Erdoğan, M. (2007). An analysıs of a newly developed fourth and fıfth grade scıence and technology course currıculum: a qualıtatıve study. Turkish Journal of Educational Sciences, 5(2), 221-259.

Erdoğan, M. (2009). Fifth grade students’ environmental literacy and the factors affecting students’ environmentally responsible behaviors, Unpublished Doctoral Dissertation, The Graduate School of Social Sciences Middle East Technical University, Ankara.

Erkal, S., Şafak, Ş., & Yertutan, C. (2011). The role of family in creating awareness of sustainable development and environment. Socioeconomic, 1(110107), 145-158.

Field, A. (2000). Discovering Statistics using SPSS for Windows. London – Thousand Oaks – New Delhi: Sage publications

Fishbein, M., & Ajzen, I. (1975). Belief, Attitude, Intention, and Behavior: An Introduction to Theory and Research. Reading, MA: Addison-Wesley.

Fraj, E., & Martinez, E. (2006). Environmental Values and Lifestyles As Determining Factors Of Ecological Consumer Behaviour: An Empirical Analysis. Journal of Consumer Marketing, 23(3), 133-144.

Geuens, M., & Pelsmacker, P. D. (2002). Validity and reliability of scores on the reduced emotional intensity scale. Educational and Psychological Measurement, 62(2), 299–315.

Gizir, S. (2005). In partial fulfillment of the requirements for the degree of doctor of philosophy in the department of educational sciences, Unpublished doctoral dissertation, Middle East Technical University, Ankara.

Hadjichambis, A.C., Paraskeva-Hadjichambi, D., Ioannou, H., Georgiou,Y., & Manoli, C.C. (2015). Integrating sustainable consumption into environmental education: A case study on environmental representations, decision making and intention to act. International Journal of Environmental and Science Education, 10, 67-86.

Hambleton, R. K., & De Jong, J. H. A. L. (2003). Advances in translating and adapting educational and psychological tests. Language Testing, 20, 127-134.

Hines, J. M., Hungerford, H. R., & Tomera, A. N. (1987). Analysis and synthesis of research on responsible environmental behavior: A meta-analysis. Journal of Environmental Education, 18(2), 1-8.

Hines, J., Hungerford, H., & Tomera, A. (1986/87). Analysis and synthesis of research on responsible environmental behavior: A meta-analysis. The Journal of Environmental Education, 18(2), 1-8.

Hollweg, K. S., Taylor, J. R., Bybee, R. W., Marcinkowski, T. J., McBeth, W. C., & Zoido, P. (2011). Developing a framework for assessing environmental literacy. Washington, DC: North American Association for Environmental Education. Available at http://www.naaee.net.

Hsu, S.J. (2004). The effects of an environmental education program on responsible environmental behaviour and associated environmental literacy variable in Taiwanese college students. Journal of Environmental Education 35(2), 37–48.

Hsu, S.J., & Roth, R.E. (1999). Predicting Taiwanese secondary teachers’ responsible environmental behavior through environmental literacy variables. The Journal of Environmental Education, 30(4), 11-18.

Hungerfold, H., Volk, T., & Ramsey, J. (1990). Science technology society investigating and evaluating STS Issues and solutions. Champaign, IL: Stipes Publishing Company.

Hungerford, H., & Peyton. R. (1976). Teaching environmental education. Portland: ME: J. Weston Walch, Publisher.

Hungerford, H.R., & Volk, T.L. (1990). Changing learner behavior through environmental education. The Journal of Environmental Education, 21(3), 8-22.

Hwang, Y.H., Kim, S. I., & Jeng, J.M. (2000). Examining the Causal Relationships among Selected Antecedents Rresponsible Environmental Behaviour. The journal of environmental education, 31(4), 19-25.

Jöreskog, K., & Sörbom, D. (2001). LISREL 8: user’s reference guide, scientific software ınternational, Lincolnwood, IL: Scientific Software International, Inc.

Karasar, N. (2006). Scientific research method. Ankara: Nobel Publishing.

Kahle, L.R. (1996). Social values and consumer behaviour: Research from the list of values. The Psychology of Values: The Ontario Symposium, 8, 135-50, New Jersey: Lawrence Erlbaum Associates Publishers

Kals, E., & Maes, J. (2002). Sustainable development and emotions. In P. Schmuck & W.P. Schultz (Eds.), Psychology of Sustainable Development (pp. 97-122). Boston, MA: Kluwer Academic Publishers.

Kaya, N.Ç. ve Turan, F. (2005). Environmental knowledge and sensitivity among eight –grade students: a study of the state and private primary schools’ sample in Ankara. Eurasian Journal of Educational Research, 21,103-112.

Kayri, M., & Günüç, S. (2009). The adaptation of internet addiction scale into turkish: the study of validity and reliability. Ankara University, Journal of Faculty of Educational Sciences, 42 (1), 57-175.

Kışoğlu, M. (2009). Investıgatıon the effect of student centered ınstructıon on of prospectıve teachers’ envıronmental lıteracy. Unpublished Doctoral Thezis, Atatürk University, Erzurum

Kollmuss, A., & Agyeman, J. (2002). Mind the gap: Why do people act environmentally and what are the barriers to. Environmental Education Research, 8(3), 239–260

Lawson, A.E., Costenson, K., & Cisneros, R. (1984). A summary of Research in science education. (ERIC Document Reproduction Service No. ED269220)

Liu, S. C., & Lin, H. (2015). Exploring undergraduate students’ mental models of the environment: Are they related to environmental affect and behavior? The Journal of Environmental Education, 46(1), 23-40.

Marcinkowski, T. (1991) The relationship between environmental literacy and responsible environmental behaviour in environmental education. In Maldague, M. (Ed). Methods and techniques for evaluating environmental education. Paris: UNESCO.

McCarty, J.A., & Shrum, L.J. (2001). The Influence of Individualism, Collectivism, and Locus of Control on Environmental Beliefs and Behaviour. Journal of Public Policy & Marketing, 20(1), 93-104.

Mcdonald, R.P., & Moon-Hoo, R. (2002). Principles and practice in reporting structural equation analyses. Psychological Methods, 7(1), 64-82.

Ministry of Education [ME] (2013). The science curriculum. Ankara: Board of Education.

Morrone, M., Mancl, K., & Carr, K. (2001). Development of a metric to test group differences in ecological knowledge as one component of environmental literacy. Journal of Environmental Education 32(4), 33–42.

Oxford English Dictionary. (1989) (2 ed.). Clarendon Press.

Ozdemir, O., & Uzun, N. (2006). The effect of science and nature activities carried out according to green class model on preschool student’s environment perception. Journal of Child Development and Education, 3(1).

Pallant, J. (2001). SPSS survival manual. a step-by-step guide to data analyses using SPSS for windows. Philadelphia, PA: Open University Press.

Pe'er, S., Goldman, D., & Yavetz, B. (2007). Environmental literacy in teacher training: Environmental attitudes, knowledge and behavior of beginning students. Journal of Environmental Education, 39(1), 45–59.

Peterson, N. (1982). Developmental variables affecting environmental sensitivity in professional environmental educators. Unpublished master’s thesis, Southern Illinois University, Carbondale.

Richardson, J.T.E. (1994). Cultural specificity of approaches of studying in higher education: a literature survey. Higher Education, 27, 449–468.

Roth, C.E. (1992). Environmental literacy: Its roots, evolution and directions in the 1990s. Columbus OH: ERIC Clearinghouse for Science, Mathematics and Environmental Education.

Rotter, J. B. (1966). Generalized expectancies for internal versus external control of reinforcement. Psychological Monographs, 80. (Whole No. 609).

Ryu, H.C., & Brody. S.D (2006). Examining the impacts of a graduate course on sustainable development using ecological footprint analysis. International Journal of Sustainability in Higher Education 7(2), 158–75.

Sadik, F., & Sarı, M. (2010). Student teachers’ attitudes towards environmental problems and their level of environmental knowledge. Cukurova University Faculty of Education Journal, 39, 129-141

Şahin, K., & Gül, S (2009). A survey of environmental knowledge ve behaviour and awareness of secondary students: Samsun sample. Kastamonu Education Journal, 17(2):541-556.

Şahin, N. (1994). Scale use of research in psychology, Turkish Journal of Psychology, 9(33),19–26.

Savaşır, I. (1994).  Some problems and solutions in scale adaptation. Turkish Journal of Psychology, 33 (9), 27-32

Savaşır, I. (1994). Problems about scale adoption and some solutions, Turkish Journal of Psychology, 9 (33), 27–32.

Şeker, H., & Gençdoğan, B. (2006). Developing measurement tools in psychology and education. Ankara: Nobel Publishing

Sever, R. & Yalçınkaya, E. (2012). Examining the Environmental Attitudes of Pre-Service Teachers on Primary School Teaching. Marmara Geographical Review, 26, 1-15.

Şimşek, Ö. F. (2006). Structural equation modeling basic principles and lisrell applications.  İstanbul: Ekinoks Publishing.

Şimşekli, Y. (2004). Sensitivity of Elemantary Schools to the Environmental Education Activities For Increasing Environmental Knowledge. Journal of the Uludağ University Faculty of Education, 17 (1), 2004, 83-92.

Sireci S.G., & Berberoğlu, G. (2000). Using bilingual respondents to evaluate translated-adapted items. Applied Measurement in Education, 13(3), 229-248.

Stables, A. (1998). Environmental literacy: functional, cultural, critical. The case of the SCAA guidelines. Environmental Education Research, 4(2), 155-164.

Sward, L.L., &Marcinkowski, T. (2001). Environmental sensitivity; A review of the research, 1980-1998. In H. Hungerford, W. Bluhm, T. Volk and J Ramsey (Eds.), Essential Readings in Environmental Education (pp. 277-288). Champaign, IL: Stipes Publishing, L.L.C.

Tabachnick, G.B., & Fidell, L.S. (2001). Using multivariate statistics (fourth edition). USA: Allyon and Bacon Press.

Tanner, T. (1980). Significant life experiences: A new research area in environmental education. The Journal of Environmental Education, 11(4), 20-24.

Taşkın, Ö. (2005). An evaluation of the studies on environmental attitude and knowledge. Education & Science, 30(138), 78- 85.

Teksoz, G., Sahin, E., & Tekkaya-Oztekin, C. (2012). Modeling environmental literacy of university students. Journal of Science Education and Technology, 21(1), 157-166

Uluçınar Sağır, Ş., Aslan, O., & Cansaran, A. (2008). The examination of elementary school students' environmental knowledge and environmental attitudes with respect to the different variables, Elementary Education Online, 7(2), 496-51

UNESCO (1989), Environmental literacy for all, Connect, 14(2), 1-2

UNESCO (1978). Final report: Intergovernmental conference on environmental education. Paris, France: Author.

Ural, A., &  Kılıç, I. (2005). Scientific research process and data analysis with SPSS. Ankara: Detay Publishing.

Uzun, N., Atlı, K., & Sağlam, N. (2010). Evaluation of the High School Students’ Environmental Attitudes and Interest Levels: Kalecik-Turkey Sample, Eurasian Journal of Educational Research, 41, 165-181.

World Commission on the Environment and Development. (1987). Our common future. Oxford: Oxford University Press.

Yavetz, B, Goldman D.,& Pe’er, S. (2009).  Environmental literacy of pre-service teachers in Israel: a comparison between students at the onset and end of their studies. Environmental Education Research. 15(4), 393-415.

Akella AK, Saini RP, Sharma MP (2009). Social, economic and environmental impacts of renewable energy systems. Renewable Energy, 34, 390–396. doi:10.1016/j.renene.2008.05.002. 

Asafu-Adjaye J (2000). The relationship between energy consumption, energy prices and economic growth: time series evidence from Asian developing countries. Energy Economics, 22 (6), 615–625. doi:10.1016/S0140-9883(00)00050-5. 

Ayres RU, Van den Berg JCJM, Lindenberger  D, Warr B (2013). The underestimated contribution of energy to economic growth. Struct. Change Econ. Dyn., 27, 79–88. doi:10.1016/j.strueco.2013.07.004.

Bergmann EA, Colombo S, Hanley N (2007). The social-environmental impacts of renewable energy expansion in scotland. The Agricultural Economics Society's 81st Annual Conference, 2nd to 4th April, University of Reading, UK. http://ageconsearch.umn.edu/bitstream/7964/1/cp07be01.pdf

Boztepe A. (2012). Green marketing and its impact on consumer buying behavior. European Journal of Economic and Political Studies, 5 (1), 5-21.

Cantrell KB, Thomas DK, Ro S, Hunt PG (2008). Livestock waste-to-bioenergy generation opportunities. Bioresource Technology, 99, 7941–7953. doi:10.1016/j.biortech.2008.02.061.

Creutzig F, Ravindranath NH, Berndes G, Bolwig S, Bright R, Cherubini F, Chum H et al (2014). Bioenergy and climate change mitigation: an assessment. GCB Bioenergy, doi: 10.1111/gcbb.12205

Daynard K, Daynard T (2011). What are the effects of biofuels and bioproducts on the environment, crop and food prices and World hunger?. GFO-Biofuels-and-Crops. http://greenfuels.org/wp-content/uploads/2011/04/GFO-Biofuels-and-Crops-2011.pdf.

Devine-Wright P (2008). Reconsidering public attitudes and public acceptance of renewable energy technologies: A critical review. T. Jamasb, M. Grubb, M. Pollitt (Eds.), Taking Climate Change Seriously: A Low Carbon Future for the Electricity Sector. Cambridge University Press, 443–461.

Devine-Wright P (2005). Local aspects of UK renewable energy development: exploring public beliefs and policy implications. Local Environment, 10, 57–69.

Field A (2008). Multiple regression: Statistical methods using IBM SPSS. C8057 (Research Methods in Psychology): Multiple Regression. education.exeter.ac.uk/download.php?id.  

Fritsche UR, Hennenberg KJ, Wiegeman K, Herrera R, Franke B, Köppen S, Reinhardt G (2010). Bioenergy Environmental Impact  Analysis (BIAS): Analytical Framework. Environment and Natural Resources Management Series 46, Food and Agriculture Organization of the United Nations, Rome.

FAO (2008). The state of food and agriculture. ISSN 0081-4539. ftp://ftp.fao.org/docrep/fao/011/i0100e/i0100e.pdf.

Gliem JA, Gliem RR (2003). Calculating, interpreting, and reporting Cronbach’s alpha reliability coefficient for Likert-type scales. Midwest Research to Practice Conference in Adult, Continuing, and Community Education, Columbus, Oct. 8-10, 2003, Ohio: Ohio State University.

Halder P, Havu-Nuutinen S, Pietarinen J, Zyadin A, Pelkonen P (2014). Subject knowledge and perceptions of bioenergy among school teachers in India: Results from a survey. Resources, 3, 599-613; doi:10.3390/resources3040599.

Halder P, Pietarinen J, Havu-Nuutinen S, Pelkonen P, Chang CY, Prokop P, et al (2013). Knowledge, perceptions and attitudes as determinants of youths' intentions to use bioenergy e a cross-national perspective. Int J Green Energy, 10(8), 797-813. DOI:10.1080/15435075.2012.706244

Halder P, Prokop P, Chang CY, Usak M, Pietarinen J, Havu-Nuutinen S, Pelkonen P, Cakir M (2012). International survey on bioenergy knowledge, perceptions and attitudes among young Citizens. Bio Energy Research 5, 247–61. DOI 10.1007/s12155-011-9121-y.

Halder P (2011). Bioenergy knowledge, perceptions, and attitudes among young citizens—from cross-national surveys to conceptual model. Dissertationes Forestales, Faculty of Science and Forestry, University of Eastern Finland.

Halder P, Pietarinen P, Havu-Nuutinen S, Pelkonen P (2010). Young citizens’ knowledge and perceptions of bioenergy and future policy implications. Energy Policy, 38, 3058–3066.

IEA (2009). Bioenergy – A sustainable and reliable energy source.

IEA (2007). Bioenergy.

IEA (2005). Benefits of bioenergy.

IRENA (2014). The socio-economic benefits of solar and wind energy.

Jadama LM (2014). Impact of subject matter knowledge of a teacher in teaching and learning process. Middle Eastern & African Journal of Educational Research, 7, 20-29. http://www.majersite.org/issue7/2_jadama.pdf.

Jaramillo-Nieves L, del Rio P (2010). Contribution of renewable energy sources to the sustainable development of ıslands: An overview of the literatüre and a research agenda. Sustainability, 2, 789-811. Doi:10.3390/su2030783.

Karytsas S, Theodoropoulou H (2014). Socioeconomic and demographic factors that influence publics' awareness on the different forms of renewable energy sources. Renewable Energy, 71, 480-485. doi:10.1016/j.renene.2014.05.059.

Kassinis S (2008). Energy Production from Renewable Sources by 2020: The Cypriot Case. DEMSEE, September 22-23, Nicosia, Cyprus.

Kassinis S (2011). The Status of Hydrocarbon Exploration in Cyprus. Israel Business Conference, Tel Aviv, 12 December.

Kollmuss A, Agyeman J (2002). Mind the Gap: why do people act environmentally and what are the barriers topro-environmental behavior? Environmental Education Research, 8, 239–260. DOI: 10.1080/1350462022014540 1

Krajhanzl J (2010). Environmental and pro-environmental behavior. School and Health, 21, 251-274.

Micangeli A, Naso V, Michelangeli E, Matrisciano A, Farioli F, Belfiore NP (2014). Attitudes toward sustainability and green economy issues related to some student learning their characteristics: A preliminary Study. Sustainability, 6, 3484-3503. doi:10.3390/su6063484

Muderrisoglu H, Altanlar A (2011). Attitudes and behaviors of undergraduate students toward environment issues. International Journal of Environmental Science and Technology, 8(1), 159-168. DOI: 10.1007/BF03326205

Omria A, Kahouli B (2014). Causal relationships between energy consumption, foreign direct investment and economic growth: Fresh evidence from dynamic simultaneous-equations models. Energy Policy, 67, 913–922. doi:10.1016/j.enpol.2013.11.067

Peskett L, Slater R, Stevens C, Dufey A (2007). Biofuels, agriculture and poverty reduction. Natural Resource Perspectives. Overseas Development Institute. http://www.odi.org/publications/3851-odi-natural-resource-perspectives.

Pickens J (2011). Attitudes and Perception. (ed. Nancy Borkowski), Organizational Behavior in Health Care. Second Edition, Miami: Jones and Barlett Publishers.

Pirlogea C, Cicea C (2012). Econometric perspective of the energy consumption and economic growth relation in European Union. Renewable and Sustainable Energy Reviews. 16, 5718–5726. Doi.org/10.1016/j.rser.2012.06.010.

Popp J, Lakner Z, Harangi-Rakos M, Fari M (2014). The effect of bioenergy expansion: Food, energy, and environment. Renewable and Sustainable Energy Reviews, 32, 559–578, doi:10.1016/j.rser.2014.01.056.

Reddy AKN (2000). Energy and social issues. World energy assessment: energy and the challenge of sustainability, UNDP.

Remedio EM, Domac JU (2003). Socio-economic analysis of bioenergy systems: A focus on employment. FAO Forestry Department Wood Energy Programme.

Steg L, Vlek C (2008). Encouraging pro-environmental behavior: An integrative review and research agenda. Journal of Environmental Psychology, 29(3), 309-317.

Stern DI (2004). Economic growth and energy. Encyclopedia of Energy, 2, 35-78.

Stern DI, Cleveland CJ (2004). Energy and economic growth. Rensselaer Working Papers in Economics. http://www.economics.rpi.edu/workingpapers/rpi0410.pdf.

Tavakol M, Dennick R (2011).  Making sense of Cronbach’s alpha. International Journal of Medical Education, 2, 53-55, DOI: 10.5116/ijme.4dfb.8dfd.

Tsoutsosa T, Frantzeskakib N, Gekasb V (2005). Environmental impacts from the solar energy technologies. Energy Policy 33, 289–296. doi:10.1016/S0301-4215(03)00241-6

UNESCO-SCOPE-UNEP (2009). Biofuels and environmental impacts. Scientific analysis and implications for sustainability. http://www.unep.org/pdf/dtie/BiofuelsEnvironmentalImpacts.pdf.

Wall G (1997). Energy, society and morals. Journal of Human Values, 3(2), 193-206.

WBA (2014). Global Bioenergy Statistics report. http://www.uabio.org/img/files/docs/140526-wba-gbs-2014.pdf.

WEF (2012). Energy for Economic Growth: Energy Vision Update 2012. Prepared in Partnership with IHS CERA. http://www3.weforum.org/docs/WEF_EN_EnergyEconomicGrowth_IndustryAgenda_2012.pdf.

Wright YL (2011). Relating recycling: Demographics, attitudes, knowledge and recycling behavior among uc Berkeley students. UC Berkeley Student Recycling, 1-17, http://nature.berkeley.edu/classes/es196/projects/2011final/WrightY_2011.pdf

Yang AG, Pearce S (2013). A Beginner’s guide to factor analysis: Focusing on exploratory factor analysis. Tutorials in Quantitative Methods for Psychology, 9(2), 79-94.

1. Smith, A. H., Lingas, E. O. & Rahman M. (2000). Contamination of drinking-water by arsenicin Bangladesh: a public health emergency Bulletin of the World Health Organization, 2000, 78 (9) # World Health Organization 1092-1103
2. Ullah, R, Malik, R. N., Qadir, A. (2009). Assessment of groundwater contamination in an industrial city Sialkot, Pakistan, African Journal of Environmental Science and Technology, 3 (12), 429-446,
3. Chen H.W., Frey M.M., Clifford D., Mcneill L.S., and Edwards M. (1999). Arsenic Treatment Considerations. Journal of the American Water Works Association, 91, 74-85
4. Chen, J. P., Wang, L., and Zou, S. W., (2008). Determination of Lead Bio-sorption Properties by Experimental and Modeling Simulation Study, Chemical Eng. J., 131, 209-215.
5. Chou S, Colman J, Tylenda C, De Rosa C. .(2007). Chemical-specific health consultation for chromated copper arsenate chemical mixture: port of Djibouti,  Toxicol Ind Health 23(4):183-208.
6. Chu LM, Wong MH. (1987). Heavy metal contents of vegetable crops treated with refuse compost and sewage sludge. Plant Soil. 103, 191–197.
7. da Silva Oliveira, A., Bocio, A., Trevilato, T. M. B., Takayanagui, A. M. M., Doming, J. L., and Segura-Munoz S. I. (2007). Heavy metals in untreated/treated urban effluent and sludge from a biological wastewater treatment plant, Environ. Sci. Pollut. Res., 14(7), 483 – 489, doi:10.1065/espr2006.10.355
8. Demirel, Z. (2007). Monitoring of heavy metal pollution of groundwater in a phreatic aquifer in Mersin-Turkey. Environ. Monit. Assess. 132(1-3):15-23
9. Fernandez, H., Conti, L. F., & Patchineelam, S. R. (1994). An assessment of the pollution of heavy metals in Jacarepagua Basin, Rio De Janeiro, Brazil: A statistical approach. Environment & Technology, 269, 87–94
10. Bonkoungou IJ, Damanka S, Sanou I, Tiendrébéogo F, Coulibaly SO, Bon F, Haukka K, Traoré AS, Barro N, Armah GE. (2011). Genotype Diversity of Group A Rotavirus Strains in Children with Acute Diarrhea in Urban Burkina Faso, 2008–2010 Journal of Medical Virology 83, 1485–1490
11. H oung K. H . & D . Y . Lee ( 1998). Compar is ons of linear and nonlinear Langmuir and Freundlich curve-f it in the study of Cu, Cd and Pb adsorption on Taiwan soils, J. Soil Sci., 163 (2), 115- 121
12. Ayotte, J. D., Nielsen, M. G., Robinson Jr., G. R., and Moore R. B. (1999). Relation of Arsenic, Iron, and Manganese in Ground Water to Aquifer Type, Bedrock Lithogeochemistry, and Land Use in the New England Coastal Basins, Water Resources Investigations Report 99-4162
13. Kavitha R. and Elangovan K., (2010). Review article on Ground water quality characteristics at Erode district, India of I.J.E.S., 1(2).
14. Lantzy and MacKenzie 1979 Global Cycling of Arsenic D. C. CHILVERSANDP. J. PETERSON Lead, Mercury, Cadmium and Arsenic in the Environment, Ed. T. C. Hutchinson and K. M. Meema @ 1987 SCOPE. Published by John Wiley & Sons Ltd, 279-298
15. Lantzy R.J. Mackenzie F.T. (1979). Atmospheric trace metals: global cycles and assessment of man’s impact, Geochim. Cosmochim. Acta, 43, 511- 525.
16. Lemly, A.D., (2002). Selenium assessment in aquatic ecosystems—a guide for hazard evaluation and water quality criteria: New York, Springer-Verlag, 3 p.
17. Sujatha M., Gopalakrishnayya, A., Satyanarayana T. (2012). Assessment Of Groundwater Quality In Rural Areas Of Vijayawada, A.P. International Journal of Engineering Research and Applications (IJERA), 2(4), 645-64
18. Marshall KC. (1979). Biogeochemistry of manganese minerals. In: Trudinger PA, Swaine DJ,415 editors. Biogeochemical Cycling of Mineral-Forming Elements. Elsevier/North 416 Holland Publishing Co., 253-286.
19. Verma N.K, Jain, O.P. and Shrivastava, P.K. (1995). Preliminary studies on heavy metals in ground water of Mandeep by Atomic Adsorption spectroscopy, Proc. Acad. Environmental Biology, 4(1):123-126.
20. Wang, J.S., Huang, P.M., Liaw, W.K., and Hammer, U.T., (1991). Kinetics of the desorption of mercury from selected freshwater sediments as influenced bychloride, Water, Air, and Soil Pollution, 56, 533-542.

Blakey, T.N. (1987). English for Maritime Studies. Great Britain: Printice Hall International (UK) Ltd.

Borg, W. R., Gall, M.D. (2003). Education Research. Boston: Perason Education.

Callum, M.C. and Smith M. V. (1999). Developing Mariner Assessment. Seattle: US Coast Guard Research and Development Centre.

Coutroubis, A. D. (2000). Experience with ER CBT and Simulator. Calmar: INSCL

Hart, D. (1994). Authentic Assessment. Addison: Wesley Publishing Company.

Hibbard, K.M. (1996). A Teacher Guide to Performance Based Learning and Assessment. Alexandria VA: Association and Curriculum Development.

International Maritime Organisation (2010). IMO SMCP. London: IMO

‪ Johnson‪, D. W., Johnson, R. T.  (2002). Meaningful Assessmentt. Allyn and Bacon: Boston USA.

Joyce, B., Weil, M., Calhoun, E. (2011). Models of Teaching. Boston: Allyn and Bacon.

Kent, L. (2003). Simulation of business Skills. Disadur pada 8 Juli 2009, dari www.srich-bi.com.

Kobayahsi, H. (2009). Mariner’s Function for Safe Navigation. Tokyo: Tokyo University of Maritime Science and Technology.

Mueller, J. (2008). Authentic Assessment Toolbox. North Central College

Mulyasa, E. 2004. Implementasi Kurikulum 2004. Bandung: Remaja Rosdakarya.

O’Malley, J. M. and Pierce, L. V. (1996). Authentic Assessment for English Language. Addison: Whisley Publishing Company.

1. Montgomery PG, Pyne DB, (2009). Cox AJ, Hopkins WG, Minahan CL, Hunt PH. Muscle Damage İnflamation, and Recovery İnterventions During a 3-day Basketball Tournament. European Journal of Sport Science, 8(5), 241-250.

2. Janeira Ma MJ. (1998). Game İntensity in Basketball an İnteractionist View Linking Time-Motion Analysis, Lactate Concentration and Heart Rate. Coach Sport Science Journal, 3, 26-30.

3. Newman MA, Tarpenning KM, Marino FE. (2004).  Relationship Between İsokinetic Knee Strength, Single-Sprint Performance, and Repeated-Sprint Agility in Football Players. J Strength Cond Res. 18(4), 867-872.

4. Pääsuke, M., Ereline, J., Gapeyeva, H. (2001). Knee Extension Strength and Vertical Jumping Performance in Nordic Combine Athletes. J. Sports Med Phys Fitness. 41, 354-361.

5. Jay RH, Shmuel E, Merav E, And Yıtzhak W. (1999). The Influence of Aerobic Capacity on Anaerobic Performance and Recovery Indices in Basketball Players. Journal of Strength and Conditioning Research, National Strength & Conditioning Association. 13(4), 407–411

6. Tricoli, V., Lamas, L., Carnevale, R. and Ugrinowitsh, C. (2005).  Short-Term Effects on Lower-Body Functional Power Development’ Weightlifting vs. Vertical Jump Training Programs’. Journal Strength Conditional Researches. 19(2), 433-7.

7. Baechle, T. R. and Earle, R. W. (2008). ‘Essentials of Strength Training and Conditioning’. (Third edition) China: Human Kinetics, 40-68

8.  Hindistan İ.E., Muratlı S., Özer M.K., Erman K.A., (1999). The Effect of Performans on Vertical Jump During Weight Training with Eccentric, Concentric and stretch and Shortening Cycle Muscle Work, Akdeniz University Physicial Education and Sports Science Journals. 3(2), 1-10.

9. Bogdanis, G. C., Ziagos, V., Anastasiadis, M. and Maridaki, M. (2007). Effect of Two Different Short – Term Training Programs on The Physical and Technical Abilities of Adolescent Basketball Players. Journal Science Medicine Sport, 10(2), 79-88

10.Orhan, S. (2013). The Effects of Rope Training on Heart Rate, Anaerobic Power and Reaction Time of the Basketball Players. School of Physical Education and Sports 10(4), 266-271

11.Sağıroğlu, İ., Konar, M., Önen, M. E., Ateş, O. ve Alkurt, Z. (2012). Genç Basketbolcularda Pliyometrik Antrenmanın Anaerobik Performans Değerlerine Etkisi. Niğde Üniversitesi Beden Eğitimi Ve Spor Dergisi, 6(3):258-264

12.Siegler, J., Gaskill, S. and Ruby, B. (2003). Changes Evaluated in Soccer-Specific Power    Endurance Either With or Without A 10-Week, in-Season, İntermittent, High-İntensity Training Protocol. Journal Strength Conditioning Research, 17(2), 379-87.

13.Fatouros, I. G., Laparidis, K., Kambas, A., Chatzinikolaou, A., Techlikidou, E., Katrabasas, I., Douroudos, I., Leontsini, D., Berberidou, F., Draganidis, D., Christoforidis, C., Tsoukas, D., Kelis, S. and Taxildaris, K. (2011). Validity and Reliability of The Single-Trial Line Drill Test of Anaerobic Power in Basketball Players. Journal Sports Medicine Physical Fitness. 51(1):33-41.

14.Humberto, M. C., Manuel, J., Coelhe, E. S., Anto´nio, J. F., Carlos, E. G.,  Renaat, M., P. Carlo, C., and Robert, M. M. (2011). Predictors of Maximal Short-Term Power Outputs in Basketball Players 14–16 Years. Euro Journal Applied physiology. 111, 789–796

15.Matavulj, D., Kukolj, M., Ugarkovic, D., Tihanyi, J. and Jaric, S. (2001). ‘Effects of Plyometric Training on Jumping Performance in Junior Basketball Players’. Journal Sport Medicine Physology Fitness, 41(2), 159-64.

16.Toumi, H., Best, T. M., Martin, A. and Poumarat, G. (2004). ‘Muscle Plasticity After Weight and Combined (Weight + Jump) Training’. Medicine Science Sports Exercises, 36(9), 1580-8

17.Akkoyunlu, Y., Şene,l Ö. ve Eroğlu, H. (2006). ‘Farklı Pozisyonlarda Uygulanan Squat Egzersizlerinin Diz Fleksiyon ve Ekstensiyon Kuvvet Gelişimine Etkilerinin İncelenmesi’. Spormetre Beden Eğitimi ve Spor Bilimleri Dergisi, 4(4), 149-154

18.Kannus, P. (1988). Knee Flexor and Extensor Strength Ratios With Deficiency of The Lateral Collateral Ligament. Architecture Physology Medicine Rehabilitation, 69(11), 928-931.

19.Orchard, J., Marsden, J., Lord, S. and Garlick, D. (1997). ‘Preseason Hamstring Muscle Weakness Associated with Hamstring Muscle İnjury in Australian Footballers’. Am Journal Sports Medicine, 25(1), 81–85.

20.Mjolsnes, R., Arnason, A., Raastad, T. and Bahr, R. A. (2004). ‘10 week Randomized Trial Comparing Eccentric vs. Concentric Hamstring Strength Training in Welltrained Soccer Players’. Scand Journal Medicine & Sciences Sports, 14(5), 311-317.

21.Miyaguchi, K., Sugiura, H. and Demura, S. (2014). Possibility of Stretch-Shortening Cycle Movement Training Using A Jump Rope. Journal of Strength and Conditioning Research, 28(3), 700-705

22.Asadi, A. (2013). Effects of in-Season Short-Term Plyometric Training on Jumping and Agility Performance of Basketball Players. Sport Sciences Health, 9, 133–137

23.Arazi, H., Coetzee, B. and Asadi, A. (2012). ‘Comparatıve Effect Of Land- and Aquatıc-Based Plyometrıc Traınıng on Jumpıng Abılıty and Agılıty of Young Basketball Players’. South African Journal for Research in Sport, Physical Education and Recreation, 34(2), 1-14.

Agopyan, A, (1993). Rhythmic gymnastics morphological characteristics of impact performance. İstanbul: Pelin Publishers.

Arslan, E. (2014). The effects of the exercise program on visual and audial reaction time of the healty children in the group of 8-11 ages. Yüzüncü Yıl University Journal of Education Faculty Sciences, 11(1): 169-182.

Başer, E. (1998). Applied sport psychology. 3rd ed. Ankara: Bağırgan Publisher.

Bompa, T.O. (2003). Training theory and method. Ankara: Bağırgan Publishers.

Biçer, G., Savucu, Y. (2008). The effect on 35-40 aged sedentary women’s foot audial-visual reaction times of step activities for 12 weeks.  Journal of New World Sciences Academy, 3(3): 138-144.

Büyükipekci, S., Taşkın, H, (2011). The effect of changes in reaction time, agility and anaerobic performance during the all season in female volleyball players. Selçuk University Journal of Physical Education and Sport Science, 13(1): 20-25.

Çakıroğlu, T., Sökmen, T, (2012). The effect of judo technique training and games on reaction times in children aged 8-10 years. Selçuk Universıty Journal of Physıcal Education and Sport Science, 14(1): 71-74.

Çatıkkaş, F., Kurt, C., Özkaya, G, (2011). The effect of hand preference on the determining of the visual and auditory simple reaction times in the combat sports. Selçuk Universiy Journal of Physical Education and Sport Science, 13(1): 109-111.

Çelik, A., Günay, E., Aksu, F, (2013). The evaluation of physical and motoric properties of elementary students ages 7-9. Dokuz Eylül University Faculty of Medicine Science, 27(1): 7-13.

Çimen, O. (1994). Effects of strength training of quick 16-17 age male table tennis players. Master's Thesis, Ankara: Gazi University.

Çolakoğlu, M., Tiryaki, S., Moralı, S. (1993). Effects on reaction time of concentration study. Journal of Sports Sciences, 4(4): 32- 45.

Davranche, K., Burke, B., Audiffren, M., Hasbroucg, T. (2006). Physical exercise facilitates motor processes in simple reaction time performence; on electromyographic analysis. Neuroscience Letters, 396: 54-56

Dube, S.P., Mungal, S.U., Kulkarni, M.B. (2015). Simple visual reaction time in badminton players: a comparative study. National Journal of Physiology, Pharmacy & Pharmacology, 5(1): 18-20.

Ergen, E., Turnagöl, H., Paker, S., Güner, R., Zergeroğlu, A.M., Cinemre, A. (1994). Physiological Profile of oil wrestlers. Paper presented in H. U.  3rd National Congress of Sports Science Abstracts H. U. Sport Science and Technology Publication. Ankara.

Fong, S.S.M., Ng, S.S.M., Chung, L.M.Y. (2013). Health through martial arts training: Physical fitness and reaction time in adolescent Taekwondo practitioners.  Health, 5(6A3): 1-5.

Göral, K., Saygın, Ö., Babayiğit, İrez, G. (2012). Examining of reaction time of professional soccer players according to their playing positions. Selçuk University Journal of Physical Education and Sport Science, 14 (1): 5-11.

Guckstein, M., Walter, S. (1972). Brain mechanism in reaction time. Brain Research, 40: 1–9.

Günaydın G, Koç H, Cicioglu I 2002. Determination of physical and physiological profiles of Turkish female national team wrestlers. Hacettepe Journal of Sport Sciences, 13(1): 25-32.

Kabakçı, A. C. (2009). The differences in reaction times of elite football, handball and ice hockey goal keepers.  Master's Thesis, Ankara: Gazi University.

Kaynar, Ö. (2014). The effect of training on pituitary gland hormones and liver enzymes in elite wrestlers. PhD Thesis, Erzurum: Atatürk University.

Kermen, O. (2002). Tennis technical and tactics. Ankara: Nobel Publishers.

Koç, H. (2013). Effect of anaerobic power on the reaction times of junior national team wrestlers. International Journal of Academic Research, 5(1): 256-260.

Kürkçü, R., Çalışkan, E., Şirinkan, A., Erciş, S. (2007). The effects of exercise on the reaction time of adolescent wrestlers. Atatürk University Journal of Physical Education And Sport Sciences, 9(4):3-11.

Muratlı, S. (1998). Child and Sports. Ankara: Bağırgan Publishers.

Polat, G. (2009). The effects of the 12-week-period basic badminton education trainings on 9 to 12 year-old kids’ motoric features and the reaction time. Master's Thesis, Adana: Çukurova University.

Sevim, Y. (2002). Training Information. 1st ed. Ankara: Nobel Publishers.

Sevim, Y. (2010). Training Information. 8th ed. Ankara: Fil Publishers.

Yıldırım, İ., Karagöz, Ş., Ocak, Y. (2011). Inspection of the effects of twelve-week tennis courses on visual and auditory reaction times of 8-10 years old girl children. Nigde University Journal of Physical Education and Sport Sciences, 5(3): 257-265.

Yoon, J. (2002). Physiological profiles of elite senior wrestlers. Sports Medicine, 32(4): 225-233.

Alexander D (2009). Psychophysiological Effects of Precompetition Anxiety on Basketball Performance. Unpublished Master Dissertation Submitted to California State University.
Amtmann J and Cotton A (2005). Strength and Conditioning for Judo. National Strength and Conditioning Association, 27(2), 26–31.,.
Artioli GG Scagliusi F Kashiwagura D Franchini E Gualano B Junior AL (2010). Scand J Med Sci Sports, (20): e177–e187, 178.
Burton D (1988). Do Anxious Swimmers Swim Slower? Re-Examining the Elusive Anxiety-Performance Relationship. Journal of Sport and Exercise Psychology, 10, 45–61.
Cerin E (2003). Anxiety Versus Fundamental Emotions as Predictors of Perceived Functionality of Pre-Competitive Emotional States, Threat, and Challenge in Individual Sports. Journal of Applied Sport Psychology, 15, 223–238.
Chishaki T Umeda T Takahashi I Matsuzaka M İwane K Matsumoto H İshibashi G.Ueno Y Kashiwa N and Nakaji S (2013). Effects Of Dehydration on İmmune Functions after a Judo Practice Session. Luminescence; 114–120
Clément JP (2001). ‘Les Arts Martiaux Et La Société Française: Sociologie Historique De L’implantation Du Jûdô Et De L’aikidô’, Daruma 8/9: 175–99
Corman AM (2003). Dictionary of Psychology. Oxford, UK: Oxford University Press.
Covassin T & Pero S (2004). The Relationship Between Self-Confidence, Mood State, And Anxiety Among Collegiate Tennis Players. Journal of sport behavior, 27, 230- 242. 
Craft LL Magyar TM Becker BJ Feltz DL (2003). The Relationship Between The Competitive State Anxiety İnventory-2 And Sport Performance: A Meta-Analysis. Journal of Sport & Exercise Psychology, pp 44-65
Drid P  Bala G Obadov S (2010). Archıves Of Bud.  Science Of Martıal Arts, 6(2), 95.
Edwards T and Hardy L (1996). The İnteractive Effects of Intensity and Direction of Cognitive and Somatic Anxiety and Selfconfidence upon Performance. Journal of Sport & Exercise Psychology, 18, 296–312.
Gant DW Cox RH (2004). The Sport Grid-Revised as A Measure of Felt Arousal and Cognitive Anxiety. Journal of Sport Behaviour, 27, 93–113.
Gil K (1978). Judo, Nedernhausen, 19- 20.
Hale BD and Whitehousei A. (1998). The Effect Of Imagery Manipulated Appraisal On Intensity And Direction. The Sport Psychologist, 12, 40–51.
Hardy L Jones G Gould D (1996). Understanding Psychological Preparation for Sport: Theory and Practice in Elite Athletes, Chichester, UK, Wiley.
Hernández-García R Carmen GT-L Gutierrez V (2009). Physiological Requirements of Judo Combat. İnternational Sport Med Journal, 10(3), 145-151.
Hoff FF (1998). Uber Den Sinn Des Budo Und Bushido In Der Heutigen Zeit. Universität Lüneburg.
Imamura R & Johnson B (2003). Kinematic Analysis of a Judo Leg Sweep: Major Outer Leg Reap - Osoto-Gari. Sports Biomechanics, 2(2), 191-201.
Kalina RM (2000). Teoria Sportów Walki. Biblioteka Trenera. COS, Warszawa.
Kolayis H and Sarı İ (2011). Anxiety, Self-Esteem and Competition Ranking Of Judokas. Archieves of Budo. 7, 11-15. Jan 3.
Lane AM, Sewell DF Terry PC Bartram D Nesti MS (1999). Confirmatory Factor Analysis of the Competitive State Anxiety Inventory–2. Journal of Sports Sciences, 17, 505- 512.
Lynette L Craft T Michelle M Betsy JB and Deborah LF (2003). The Relationship Between the Competitive State Anxiety İnventory–2 and Sport Performance: A Meta-Analysis. Journal of Sport & Exercise Psychology, 25, 44–65.
Martens R Vealey RS and Burton D (1990). Competitive Anxiety in Sport. Champaign, II: Human Kinetics.
Matsumoto DR (1996). An Introduction to Kodokan Judo. Tokyo, Japan: Hon-No- Tomosha, pp. 43–69.
Maynard IW, Hemmings B, Warwick-Evans L (1995). The Effects of A Somatic İntervention Strategy on Competitive State Anxiety and Performance in Semi-Professional Soccer Athletes. The Sport Psychologist, 9, 51–64. 
Mellalieau SD, Hanton S, Jones G (2003). Emotional Labeling and Competitive Anxiety in Preparation and Competition. The Sport Psychologist,17, 157–174.
Miarka B, Marques JB & Franchini E (2011). The International Journal of the History of Sport Reinterpreting the History of Women's Judo in Japan. The İnternational Journal of the History of Sport, 28(7), 1016–1029.
Modroño C and Guillen F (2010). Anxiety Characteristics of Competitive Windsurfers: Relationships with Age, Gender, and Performance Outcomes. Journal of Sport Behavior, 34(3):281-294.
Murphy S (2005). The Sport Psych Handbook (Ed.), Human Kinetics Publisher, İnc. Champaign.
Nishime RS (2007). Martial Arts Sports Medicine: Current İssues and Competition Event Coverage. Curr Sports Med Rep 6, 162–169.
Parfitt G. and Pates J. (1999). The Effects of Cognitive and Somatic Anxiety and Self-Confidence on Components of Performance During Competition. Journal of Sports Science, 17, 351–356.
Patel DR, Omar H, and Terry M (2010). Sport-Related Performance Anxiety in Young Female Athletes. Journal of Pediatric and Adolescent Gynecology, 6 , 325-335.
Pocecco E Gatterer H, Ruedl G Burtscher M (2012). Specific Exercise Testing in Judo Athletes. Archives Of Budo Science Of Martial Arts, 8(3), 133.
 Detanico D Pupo JD Franchini E Giovana dos Santos S (2012). Relationship of Aerobic and Neuromuscular Indexes with Specific Actions in Judo. Science & Sports, 27, 16-22. 
Sato S. (2013). The Sportification of Judo: Global Convergence and Evolution. Journal of Global History, 8(2), 299-317
Spielberg, CD (1966). Theory and Research on Anxiety. in C.D.Spielberg (Ed.), Anxiety and Behaviour New York: Akademik Press, pp.3-20.
Spielberger C, Hackfort D (1989). Anxiety in Sports: An International Perspective New York: Hemisphere, 55–74.
Triki M Rebai H Abroug T Masmoudi K Fellmanndn N Zouari N Tabka Z (2012). Comparative Study of Body Composition and Anaerobic Performance Between Football and Judo Groups. Science & Sports, 27, 293—299.
Tsopani D, Dallas G, and Skordilis E. K (2011). Competitive State Anxiety and Performance in Young Female Rhythmic Gymnasts. Perceptual and Motor Skills,112(2),  549-560.
Vadocz EA, Hall CR, and Moritz SE (1997). The Relationship Between Competitive Anxiety and İmagery Use. Journal of Applied Sport Psychology, 9, 24 1–253.
Weinberg RS Gould D (1998). Foundations of Sport and Exercise Psychology (3nd Ed.). Champaign, IL, Human Kinetics.
Woodman T Hardy T (2003.) The Relative Impact of Cognitive Anxiety and Self-Confidence upon Sport Performance: A Meta-Analysis. Journal of Sport Sciences, 21, 443–457

Avşaroğlu S. (2007). Selçuk University Social Sciences Institute Department of Educational Sciences Department of Psychological Services in Education. Doctorate Thesis, Konya.

Brown EJ and Mann L (1991). The Relationship Between family Structure and Process

 Dalkılıç M. (2015). The Anthropologist, International Journal of Contemporary and Applied Studies Of Man. 21(1,2): 31-38 (2015) Delhi, India.

Deniz, E. (2004). Eğitim Araştırmaları Dergisi. 4 (15), 25-35.

De Bono, Edward, (1989), Başarı Taktikleri, İlgi Yayıncılık.

Demirbaş H (1992). Comparing Decision Making Behaviours of Guilty and Not Guilty Teenagers, Master Thesis, Ankara University Social Sciences Institute, Ankara.

Ersever ÖH (1996). Karar Verme Stratejileri Kazandırma Programın ve Etkileşim Grubu Deneyiminin Üniversite Öğrencilerinin Karar Verme Stilleri Üzerine Etkileri, Ankara.

Mann, et al. (1998). Cross-Cultural Differences in Self-Reported Decision-Making Style and Confidence. International Journal of Psychology, 33, 325-335.

 Newell BR, Rakow T., Weston NT, Shanks DR (2004) Search Strategies in Decision Making: The Success of ‘Success, Journal of Behavioural Decision Making.10

Tenenbaum G, Eli MB (1993) Decision making in Sport: A cognitive Perspective, Handbook of Research of Sport Psychology, Macmillan Publishing Company New York.

Akgül B M (2011). Analysis of Leisure Attitudes of the Individuals from Different Cultures: Examples of Ankara- London, Health Sciences Institute of Gazi University, PHD Thesis, Ankara,xi-93.

Akgül B M, Gürbüz B (2010). Leisure Attitude Scale: A Study of Validity and Reliability. 11. International Sports Sciences Congress, Antalya.

Akyüz H (2015).  Analysis of the Leisure Attitudes of the University Students: Example of Bartın University. Institute of Educational Sciences of Bartın University, Master’s Thesis, 88.

Arslan S (1996). A Research on the Recreation Problems of the Female Students Staying in the Dormitories Affiliated to General Directorate of Credit and Dormitories, Institute of Health Sciences of Gazi University, Master’s Thesis in Department of Physical Education and Sports, Ankara.

Ayyıldız T (2015). An Analysis of the Leisure Satisfaction Levels of the Individuals Engaged in Recreative Dance Activities, Institute of Health Sciences of Gazi University, Master’s Thesis, Ankara.

Brown A B, Frankel B G(1993). Activity through years: leisure, leisure satisfaction, and life satisfaction. Sociology of Sport Journal, 10, 1-17.

Budak S (2000). Psychology Dictionary. Ankara:  Science and Art Publishing House, 226.

Çelik Z (2014). Analysis of the Leisure Attitudes of the Students of Ankara Police College. Institute of Health Sciences of Gazi University, Master’s Thesis, Ankara,45.

Deng J, Walker G J, Swinnerton G (2005) Leisure Attitudes: A Comparison between Chinese in Canada and Anglo-Canadians. Leisure/Loisir. 29(2): 239-273.

Diener, E. D., Emmons, R. A., Larsen, R. J., and Griffin, S. (1985). The satisfaction with life scale. Journal of Personality Assessment, 49(1), 71-75.

Durak M, Senol-Durak E, Gencoz T (2010). Psychometric properties of the satisfaction with life scale among turkish university students, correctional officers, and elderly adults. Social Indicators Research, 99(3), 413-429.

Emiroğlu K, Aydın S (2003). Ethnology Dictionary, Ankara: Science and Art Publishing House, 204-205.

Gündoğar D , Gül S S, Uskun E, Demirci S, ve  Keçeci D. (2007 The Examination Of Factors Predicting University Students’ Life Satisfaction. Clinical Psychiatry 10, 14-27.

Güney S (2014). Davranış Bilimleri. Nobel Academic Publishing. 8. press. İstanbul.

Karunaanithy K, Karunanithy M., (2014). Leisure Activities and Attitudes of Advanced Level Students: a Study based on Urban Schools in Trincomalee District. European Journal of Business and Management, 6(7). 2014

Karabulut  Ö Ö, Özer M (2003). Life Satisfaction in the Elderly. Geriatrics. 6(2),72-74.

Karakaş Türker N, Turanlı N (2008). Development of Attitude Scale for Mathematics Education Courses. Gazi University, Journal of Educational Sciences Faculty of Gazi University, 28(3), 17-29.

Karaküçük, S, Gürbüz B (2007). Recreation and Urban(ization). Ankara: Gazi Publishing House, 19-38.

Karaman, M. (2015).  Analysis of Job Satisfaction and Desperation Levels of the Individuals Engaged in Recreational Sports, Faculty of Social Sciences of Gazi University, Master’s Thesis, Ankara.

Kaya A M (2011). Analysis of the University Students’ Attitudes Towards Recreative Activities and Their Leisure Motivations on the Basis of Various Variants. Institute of Health Sciences of Cumhuriyet University. Sivas.

Kaya S, Gürbüz B (2015). An Examination of University Students’ Attitudes Towards Leisure Activities. Pamukkale Journal of Sport Sciences.6(3), 46-59.

Khong Chiu, L. (2009) University Students’ Attitude, Self-Efficacy and Motivation Regarding Leisure Time Physical Participation. Jurnal Pendidik dan Pendidikan, Jil. 24, 1–15.

Koçakoğlu M, Türkmen L (2010). Development of Attitude Scale for Biology Course. Journal of Faculty of Sciences of Ahi Evran University, 11(2), 229-24.

Kovacs, A. (2007). The Leisure Personality: Relationships Between Personality, Leisure Satisfaction, And Life Satisfaction, Phd. Thesis, Indiana University School of Health, Indiana, 29.

Öner, F. S. (2014). Factors Influencing the Life Satisfaction of the Elderly Staying in Nursing Homes. Master’s Thesis. Institute of Health Sciences of Istanbul University. İstanbul,4-49.

Özgen, F. (2012). Ç.O.M.U Analysis of the Life Satisfaction Levels of the Students of the Physical Education and Sports College. Undergraduate Thesis. College of Physical Education and Sports of Çanakkale On Sekiz Mart University, Çanakkale,2-32.

Özgür, G., Babacan Gümüş, A., ve Durdu, B. (2010). Life Satisfaction Of University Students Staying At Home And At a Dormitory. Psychiatry Nursing Journal, 1(1), 25-32.

Pala A., Biner M., Öncen S., Kargün M., (2015). Analysis of the Leisure Attitudes of the Football Tennis Players. International Sports, Exercise and Training Journal. 1(2), 77-82.

Pauperio, T., Corte-Real, N., Dias, C., and Fonseca, A. (2012). Sport, substance use and satisfaction with life: what relationship?  European Journal of Sport Science, 12(1), 73-80.

Polat, A. (2014). Examination of the Job Satisfaction and Burnout Levels of the Turkish National Police Personnel Who carry out Physical Exercises and the Ones Who Do not (Example of Sakarya Province). Faculty of Educational Sciences of Sakarya University, Master’s Thesis, Sakarya.

Ragheb MG, Beard JG. (1982). Measuring Leisure Attitude. Journal of Leisure Research, 14 (2), 155-167.

Shinn G. (2004). Miracle of Motivation. 8th Edition. Translated by: Kaplan U.İstanbul: Sistem Publishing House.

Şimsek, E. (2011). Impacts of Organizational Communication and Personal features. PHD Thesis. Institute of Social Sciences of Anadolu University. Eskişehir,8-186.

Şahin S. (2008). Burnout Levels and Life Satisfaction Levels of Teachers of Physical Education and Sports. Institute of Health Sciences of Mersin University, Master’s Thesis, Mersin.

Taylor S. E, Peplau, L. A, Sears, D. O. (2007). Social Psychology. Translated by.Ali Dönmez. İmge Publishing House, Ankara.

Torkildsen, G. (2005). Leisure and recreation management (5. press). London: Chapman & Hall, 46.

Turkish Language Society. (2005). Turkish Dictionary (10th Edition). Ankara: TDK.

Tuzgöl Dost, M. (2007). Analysis of Students’ Life Satisfaction According to Some Variants. Journal of Faculty of Educational Sciences of Pamukkale University. 22(2),132-143.

Tümkaya, S., Çelik, M., ve Aybek, B. (2011). Examination Of High School Students’ Submissive Behaviours, Automatic Beliefs, Despair, And Life Satisfaction. Ç.Ü. Social Sciences Institute Journal, 20 (2), 77-94

Uçal Canakay, E. (2006). Development of Attitude Scale for Music Theory Course. Statement in National Music Education Symposium, 297-310.

Yerlisu Lapa, T., Ağyar, E., Bahadır, Z. (2012). Life Satisfaction: Leisure Motivation, Leisure Participation: An Analysis of Teachers of Physical Education and Sports (Example of Kayseri Province). Spormetre Journal of Physical Education and Sports, X (2) 53-59.

Ahmed A.A. (2013). Estimation of stature from the upper limb measurements of Sudanese adults. Forensic Sci Int. 10, 228(1-3), 178.e1-7.
Aktas, Y., Gokhan, İ. & Aysan, H.A. (2013). Comparison of some physical and anthropometric parameters and examination of relationship between them in volleyball players in different leagues. International Educational e-Journal, Volume-II, Issue-IV.
Barut, Ç., Demirel, P. & Kıran, S. (2008) Evaluation of hand anthropometric measurements and grip strength in basketball, volleyball and handball players. Anatomy 2, 55-59.
Barut, Ç., Demirel, P. & Kıran, S. (2008). Evaluation of hand anthropometric measurements grip strength in basketball, volleyball and handball players. Anatomy 2, 55-59.
Chandrasekaran, B., Ghosh, A., Prasad, C., Krishnan, K. & Chandrasharma, B. (2010) Age and anthropometric traits predict handgrip strength in healthy normals. J Hand Microsurg. 2(2), 58-61.
Chatterjee, S. & Chowdhuri, B.J. (1991). Comparison of grip strength and isomeric endurance between the right and left hands of men and their relationship with age and other physical parameters. J Hum Ergol (Tokyo). 20(1), 41-50.
Clerke, A.M., Clerke, J.P. & Adams, R.D. (2005). Effects of hand shape on maximal isometric grip strength and its reliability in teenagers. J Hand Ther. Jan-Mar, 18(1), 19-29.
de Souza, M.A., de Jesus Alves de Baptista, C.R., Baranauskas Benedicto, M.M., Pizzato, T.M. & Mattiello-Sverzut, A.C. (2014) Normative data for hand grip strength in healthy children measured with a bulb dynamometer: A cross-sectional study. Physiotherapy. 100(4), 313-318.
España-Romero, V., Artero E.G., Santaliestra-Pasias A.M., Gutierrez, A., Castillo, M.J. & Ruiz, J.R. (2008). Hand span influences optimal grip span in boys and girls aged 6 to 12 years. J Hand Surg Am. 33(3), 378-384.
Fallahi, A.A. & Jadidian, A.A. (2011) The effect of hand dimensions, hand shape and some anthropometric characteristics on handgrip strength in male grip athletes and non-athletes. J Hum Kinet, 29, 151–159.
Ferreira,A.C., Shımano,A.C., Mazzer, N.,Barbieri, C.H., etc. (2011) Grip and pinch strength in healthy children and adolescents. Acta Ortop Bras. 19(2), 92-97.
Fransson C & Winkel J. (1991) Hand strength: The influence of grip span and grip type. Ergonomics. 34(7), 881-892.
Fuster, V., Jerez, A. & Ortega, A. (1998) Anthropometry and strength relationship: male-female differences. Anthropol Anz. 56(1), 49-56.
Habibi, E., Soury, S. & Zadeh, A. H. (2013) Precise evaluation of anthropometric 2D software processing of hand in comparison with direct method. J Med Signals Sens. 3(4), 256–261.
Ibeachu, P.C.  Abu, E.C. & Didia, B.C. (2011). Anthropometric sexual dimorphism of hand length, breadth and hand indices of university of port-harcourt students. Asian Journal of Medical Sciences. 3(8), 146-150.
Ishak, N.I., Hemy, N. & Franklin, D. (2012) Estimation of stature from hand and handprint dimensions in a western Australian population. Forensic Sci Int. 10, 216(1-3), 199.e1-7.
Jee, S.C. & Yun, M.H. (2015). Estimation of stature from diversified hand anthropometric dimensions from Korean population. J Forensic Leg Med. 35, 9-14.
Jiang, L., Jian Yao, J., Li, B., Fang, F., Zhang, O. & Meng, M.O.H. (2012) Automatic body feature extraction from front and side images. A Journal of Software Engineering and Applications, 5, 94-100.
Kaplan, D.Ö., Baydil, B. & Duvan A. (2014). Determination of somatotype features and differences between the dominant-nondominant hand grip strengths of elite female fencers. 13. International Sport Sciences Congress. P: 254-255. 7-9 November 2014, Konya, Turkey.
Koley, S. & Singh A. P. (2010). Effect of hand dominance in grip strength in collegiate population of Amritsar, Punjab, India. Anthropologist, 12(1), 13-16.
Kulaksiz G. & Gözil R. (2002). The effect of hand preference on hand anthropometric measurements in healthy individuals. Ann Anat. May, 184(3), 257-265.
Lieber. R L. (2002). Skeletal muscle structure, function and plasticity (2nd ed.). Baltimore: Lippincott, Williams & Wilkins
Lin, C.H., Lin, P. T. & Chao,Y. (2015). Hand surface area variation analyzed by 3D laser scan measurement. Proceedings of the Second European Academic Research Conference on Global Business, Economics, Finance and Banking. Zurich-Switzerland, 3-5 July 2015.
Lohman, T.G., Roche, A.F. & Martorell, R.M. (1998) Anthropometric standardization referance manual. Champaign. Human Kinetics Books.
Meunier, P. & Yin, S. (2000) Performance of a 2D image-based anthropometric measurement and clothing sizing system. Appl Ergon. 31(5), 445-451.
Mirmohammadi, S.J., Mehrparvar, A.H., Mostaghaci, M., Davari, M.H., Bahaloo, M. & Mashtizadeh, S. (2015) Anthropometric hand dimensions in a population of Iranian male workers in 2012. Int J Occup Saf Ergon. 14, 1-17.
Miyatake, N., Miyachi, M., Tabata,I., Sakano, N., Hirao, T. & Numata, T. (2012) Relationship between muscle strength and anthropometric, body composition parameters in Japanese adolescents.  Health. Vol.4, No.1, 1-5
Nevill, A.M. & Holder, R.L. (2000) Modelling handgrip strength in the presence of confounding variables: Results from the allied Dunbar national fitness survey. Ergonomics. 43(10), 1547-1558
Newman, D.G., Pearn, J., Barnes, A., Young, C.M., Kehoe, M. & Newman, J. (1984) Norms for hand grip strength. Arch Dis Child. 59(5), 453-459.
Nicolay, C.W. & Walker, A.L. (2005) Grip strength and endurance: influences of anthropometric variation, hand dominance, and gender. International Journal of Industrial Ergonomics. 35(7), 605–618.
Öcal, D. Baydil, B. & Melekoğlu T. (2010) Comparison of anthropometric measurements of dominant hands between adult elite volleyball players and sedentaries. Ovidius University Annals, Series Physical Education and Sport- Scıence, Movement and Health, 10(2), 546-548. 
Paulis, M.G. (2015) Estimation of stature from handprint dimensions in Egyptian population. J Forensic Leg Med. 34, 55-61.
Ploegmakers, J.J., Hepping, A.M., Geertzen, J.H., Bulstra, S.K. & Stevens, M. (2013) Grip strength is strongly associated with height, weight and gender in childhood: a cross sectional study of 2241 children and adolescents providing reference values. J Physiother. 59(4), 255-261.
Rogers, M.S., Barr, A.B., Kasemsontitum, B. & Rempel, D.M. (2008). A three-dimensional anthropometric solid model of the hand based on landmark measurements. Ergonomics. 51(4), 511-526.
Ruiz, J.R., España-Romero, V., Ortega, F.B., Sjöström, M., Castillo, M.J. & Gutierrez, A. (2006). Hand span influences optimal grip span in male and female teenagers. J Hand Surg Am. 31(8), 1367-1372.
Semproli S., Brasili P., Toselli S., Ventrella A.R., Jürimäe J. & Jürimäe T. (2007). The influence of anthropometric characteristics to the handgrip and pinch strength in 6-10-year old children. Anthropol Anz. 65(3), 293-302.
Skirven, T.M. & Osterman. L.A. (2011). Rehabilitation of the hand and upper extremity. (6.Ed.) Elsevier Mosby, Philadelphia
Smrithi Shetty C, Shibin Girish Parakandy & Nagaraja S. (2012). Influence of various anthropometric parameters on handgrip strength and endurance in young males and females. Int J Biol Med Res. 3(3), 2153-2157.
Tajika, T., Kobayashi, T., Yamamoto, A., et. al. (2015). Relationship between grip, pinch strengths and anthropometric variables, types of pitch throwing among Japanese high school baseball pitchers. Asian J Sports Med. 6(1), e25330
Tormo, J. M. C., Turpin, J. A. P., Cuevas, Á. G. L., et. (2013). Handgrip strength and hand dimensions in high-level inter-university judoists. Archives of Budo. (1)9, 21-28.
Uhrová, P., Beňuš, R., Masnicová, S., Obertová, Z., Kramárová, D., Kyselicová, K., Dörnhöferová, M., Bodoriková, S. & Neščáková, E. (2015). Estimation of stature using hand and foot dimensions in Slovak adults.  Leg Med (Tokyo). 17(2), 92-97.
van den Tillaar, R. & Ettema, G. (2004). Effect of body size and gender in overarm throwing performance. Eur J Appl Physiol. 91(4), 413-418.
Visnapuu, M. & Jürimäe, T. (2007). Handgrip strength and hand dimensions in young handball and basketball players. J Strength Cond Res. 21(3), 923-929.
Visnapuu, M. & Jürimäe, T. (2008). The influence of basic body and hand anthropometry on the results of different throwing tests in young handball and basketball players. Anthropol Anz. 66(2), 225-236.
Weiner, J.S., Lourie, J.A. (Ed). (1988). Pratical human biology. Academic Press. London
Yu, A., Yick, K.L., Ng, S.P. & Yip, J. (2013). 2D and 3D anatomical analyses of hand dimensions for custom-made gloves. Appl Ergon. 44(3), 381-392

Ames C. (1992). Classrooms: Goals, structures, and student motivation. Journal of Educational Psychology, 84, 261–271.

Arıburun B, Aşçı F.H. (2005).  A Study of Goal Orıentatıon and Motıvatıonal Climate in American Football. SPORMETRE, 3(3) 111-114.

Bray S, Balaguer I, Duda, J.L. (2004). The Relationship of Task Self-efficacy and Role Efficacy Beliefs to Role Performance in Spanish Youth Soccer. Journal of Sport Sciences, 22 (5), 429-437.

Duda J. L, Nicholls, J. G, (1992). Dimensions of Achievement Motivation in Schoolwork And Sport. Journal of Educational Psychology, 3, 290-299.

Duda J.L. (1989). Relationship Between Task and Ego Orientation and The Perceived Purpose Of Sport Among High School Athletes. Journal of Sport and Exercise Psychology, 11, 318-335.

Gencer E, İlhanE.L (2009). The Relatıonshıp Between Goal Orıentatıon and Motivational Climate in Badminton Athletes. 4. Raket Sporları Sempozyumu.

Halvari H, Skjesol K, Bagøien T.E. (2011). Motivational Climates, Achievement Goals, and Physical Education Outcomes: A Longitudinal Test of Achievement Goal Theory. Scandinavian Journal of Educational Research. Vol. 55, No. 1, February, 79–104.

Jaakkola T, Digelidis N. (2007). Establishing a positive motivational climate in physical education. (J Liukkonen, YV Auweele, D Alfermann, Y Theodorakis, Ed.), Psychology for Physical Educators, Student in Focus (s.4-16). (2nci Baskı). Champaign, IL: Human Kinetics.

Kazak Z, Moralı S, Doğan B. (2002). Goal orıentatıon, sport competence and lıfe satısfactıon: As predıctors of motıvatıon. VII.Uluslararası Spor Bilimleri Kongresi. 27-29 Ekim, Antalya.

Ntoumanis N. (2001). Empirical Links Between Achievement Goal Theory and Self-DeterminationTheory in Sport.  Journal of Sports Sciences 19, 397-409.

Pensgaard A. M, Roberts G.C. (2002). Elite Athletes’ Experiences of the Motivational Climate: The Coach Matters. Scandinavian Journal of Medicine and Science in Sports, 12, 54 – 59.

Roberts G.C, Ommundsen Y. (1996). Effect Of Goal Orientation On Achievement Beliefs, Cognition And Strategies İn Team Sport. Scandinavian Journal of Medicine Science and Sport, 6, 46-56.

Sage L, Kavussanu M. (2007). The Effects of Goal Involvement on Moralbehavior in an Experimentally Manipulated Competitive Setting. Journal of Sport &Exercise Psychology, 29, 190-207.

Stephens, D.E. & Bredemeier, B.J.L. (1995). Moral atmosphere and judgments about aggression in girls’ soccer: Relationship among moral and motivation variables. J Sport Exer Psychology, 18, 158-173.

Stornes T, Ommundsen Y. (2004). Achievement Goals, Motivational Climate and Sports personship: a study of young handball players. Scandinavian Journal of Educational Research, 48(2), 205-221.

Toros T, Akyüz U, Bayansalduz M, Soyer F. (2010). Examining the relationship between task-and ego-oriented goals and life satisfaction (A study of people doing mountaineering sports). International Journal of Human Sciences. 7(2), 1039-1050.

Toros T, Duvan A. (2011). Rhe Relatıonshıp Between Perceived Coaching Behaviors Collective Efficacy and Goal Orientation Among Fencer Players İn Turkey. Niğde University Journal of Physical Education and Sport Sciences, 5(1), 33-41.

Toros T. (2002). Goal Orientatıon, Motıvatıonal Climate And Life Satisfaction Among Elite and Non-Elite Male Basketball Players In Turkey. Hacettepe Journal of Sports Science. 13(3), 24-36.

Üngür G. (2009). The Relationshıp etween Goal Orientatıo and Perceived Motivatıonal Climate in Amateur and Professional Footballers. Master Thesis, Ege University, İzmir-Turkey.

Van-Yperen N. W, Duda J. L. (1999). Goal Orientations, Beliefs About Success, and Performance Improvement Among Young Elite Dutch Soccer Players. Scandinavian Journal of Medicine and Science in Sports, 9, 358 – 364.

Walling M. D, Duda, J. L, Chi, L. (1993). The Perceived Motivational Climate İn Sport Questionnaire: Construct and Predicative Validity. Journal of Sport and Exercise Psychology, 15, 172-183.

Whitehead J, Andreé KV, Lee MJ. (2004). Achievement Perspectives and Perceived Ability: How Far Do Interactions Generalize in Youth Sport? Psychology of Sport and Exercise 5, 291-317.

Yılmaz Z, Çobanoğlu G, Yazıcılar İ, Aktaş Z. (2009). The Relationship Between Goal Orientation and Game Success Among Male Professional Basketball Players. Celal Bayar University Journal of Physical Education and Sport Sciences 4(3), 124-131.

Azar, A. (2010). In-service and Pre-service Secondary Science Teachers’ Self-Efficacy Beliefs About Science Teaching, Educational Research and Reviews, 5(4), 175-188.

Bandura, A. (1986). Social foundations of thought and action. A social cognitive theory. Englewood Cliffs. NJ: Prentice Hall.

Bandura, A. (1994). Self-Efficacy. In V. S. Ramachaudran (Ed.), Encyclopedia of human behavior (Vol. 4, pp. 71-81). New York: Academic Press. (Reprinted in H. Friedman [Ed.], Encyclopedia of mental health. San Diego: Academic Press. 

Berkant, H. G. & Ekici, G. (2007). Sınıf Öğretmeni Adaylarının Fen Öğretiminde Öğretmen Özyeterlik İnanç Düzeyleri ile Zeka Türleri Arasındaki İlişkinin Değerlendirilmesi. Journal of Çukurova University Institute of Social Sciences, 16(1), 113-132.

Bümen, N. T. & Özaydın, T. E. (2013). Changes on Teacher Self-Efficacy and Attitudes towards Teaching Profession from Candidacy to Induction. Education and Science, 38,(169),109-125.

Czerniak, C. M. & Lumpe, A. T. (1996). Relationship between teacher beliefs and science education reform. Journal of Science Teacher Education, 7(4), 247-266.

Demirci, N. (2004). Students’ attitudes toward introductory physics course, Hacettepe University Journal of Education, 26, 33-40.

Demirtaş, H., Cömert, M., & Özer, N. (2011). Pre-Service Teachers’ Self-Efficacy Beliefs and Attitudes towards Profession. Education and Science, 36 (159), 96-111.

Doğan, M. (2004). Aday öğretmenlerin matematik hakkındaki düşünceleri: Türk ve İngiliz öğrencilerin karşılaştırılması. Yüzüncü Yıl Üniversitesi Eğitim Fakültesi Dergisi, 1(2), 1-14.

Durdukoca, Ş. F. (2010). Sınıf öğretmeni adaylarının akademik öz yeterlik algılarının çeşitli değişkenler açısından incelenmesi. Abant İzzet Baysal Üniversitesi Dergisi, 10(1), 69-77.

Ekici, G. (2009). Biyoloji öğretmenlerinin laboratuvar kullanımı öz-yeterlik algılarının incelenmesi.  Journal of Kırşehir Education Faculty, 10(3), 25-35.

Ergin, İ., Ünsal, Y., & Tan, M., (2006). 5E Modeli’nin Öğrencilerin Akademik Başarısına ve Tutum Düzeylerine Etkisi: Yatay Atış Hareketi” Örneği. Journal of Kırşehir Education Faculty (KEFAD), 7(2), 1-15

Güvenç, H. (2011). Öğretmen adayı öğrencilerin mesleki öz yeterlilik algıları ile öğrenci başarısı sorumluluk algıları. e-Journal of New World Sciences Academy Education Sciences, 6(2), 1410-1421.

Güzel, H. (2001). İlköğretim okullarındaki I ve II kademedeki fen bilgisi derslerinde laboratuvar etkinlikleri ve araç kullanımı düzeyi. IV. Natural Sciences Congress, Ankara: MEB Publications.

Hançer, A. H., (2008). Fen bilgisi öğretmen adaylarının fizik dersine yönelik tutumları, Contemporary Education Journal, 33(354), 11-18.

Hofstein, A., & Lunetta, N.N. (2004). The Laboratory in Science Education: Foundations for the Twenty-First Century. Science Education, 88, 28 – 54.

Hutzler, Y., Zach, S., & Gafni, O. (2005). Physical education students’ attitudes and selfefficacy towards the participation of children with special needs in regular classes, European Journal of Special Needs Education, 20(3), 309-327.

İpek, C. & Acuner, H. Y. (2011).  Sınıf Öğretmeni Adaylarının Bilgisayar Öz-Yeterlik İnançları ve Eğitim Teknolojilerine Yönelik Tutumları. Journal of Kırşehir Education Faculty, 12(2): 23-40.

Karakuş, F. & Akbulut, Ö.E. (2010). The Effect of Secondary School Teachers’ Preparation Program on the Pre-service Teachers’ Self-efficacy Beliefs. Faculty of Necatibey Education Journal of Science and Mathematics Education (EFMED), 4(2):  110129.

Kaya, H. & Böyük, U. (2011). Fen Bilimleri Öğretmenlerinin Laboratuvar Çalışmalarına Yönelik Yeterlikleri, Erciyes University Journal of the Institute of Science and Technology 27(1): 126-134.

Kaya, V.H., Polat, D. & Karamüftüoğlu, İ.Ö. (2014). “Fen Bilimleri Öğretimine Yönelik ÖzYeterlik Ölçeği Geliştirme Çabası.” The Journal of Academic Social Science Studies (JASSS). Doinumber:http://dx.doi.org/10.9761/JASSS2490, n.28, Autumn II, 581-595.

Kurbanoğlu, N. İ. & Akın, A. (2010). The relationships between university students’ chemistry laboratory anxiety, attitudes, and self-efficacy beliefs. Australian Journal of Teacher Education, 35(8), 48-59.

Lazarowitz, R. & Tamir, P. (1994). Research on using laboratory instruction in science. In D. Gable (Ed). Handbook of research on science teaching. New York: Macmillan Publishing.

Lewitt, K., E. (2001). “An Analysis of Elementary Teachers’ Belief Regarding The Teaching and Learning of Science” Science Education, 86 (1), 1-22.

Morgil, İ., Seçken, N. & Yücel, S. (2004). Kimya öğretmenlerinin öz-yeterlik inançlarının bazı değişkenler açısından incelenmesi, BAÜ Fen Bilimleri Enstitüsü Dergisi, 6(1), 62-72. 

Musheno, B.V. & Lawson A.E. (1999). Effects of Learning Cycle and Traditional Text on Comprehension of Science Concepts by Students at Differing Reasoning Levels. Journal of Research in Science Teaching, 36 (1), 23-37.

Oğuz, A. (2012). Sınıf öğretmeni adaylarının akademik öz-yeterlik inançları. Anadolu Journal of Educational Sciences International, 2(2),15-28.

Özdemir, M. ve Azar, A. (2004). Fen öğretmenlerinin laboratuvar derslerine yönelik tutumları, XIII. National Educational Sciences Congress 6-9 July 2004 İnönü University, Malatya.

Piburn, M.D., & Baker, D. R. (1993). If I were the Teacher…Qualitative Study of Attitude Toward Science. Science Teacher Education, 77(4), 393-406.

Riggs, I. M., & Enochs, L. G. (1990). Toward the development of an elementary teacher’s science teaching efficacy belief instrument. Science Education, 74 (69), 625637.

Saracaloğlu, A. S. & Yenice, N. (2009). Investigating the self-efficacy beliefs of science and elementary teachers with respect to some variables. Journal of Theory and Practice in Education. 5(2), 244- 260.

Senemoğlu N. (2005). Gelişim, Öğrenme ve Öğretim: Kuramdan Uygulamaya. 12. Press. Gazi Bookstore: Ankara.

Taşkın, Ş. Ç. & Hacıömeroğlu, G. (2010). Öğretmen özyeterlik inanç ölçeğinin Türkçe’ye uyarlanması ve sınıf öğretmeni adaylarının özyeterlik inançları. Dokuz Eylül University Buca Journal of Education, 27.

Taşlıdere, E. & Eryılmaz, A. (2012). Basit elektrik devreleri konusuna yönelik tutum ölçeği geliştirilmesi ve öğrencilerin tutumlarının değerlendirilmesi. Journal of Science Education, 9 (1), 31-46.

Tavşancıl, E. (2006). Tutumların Ölçülmesi ve SPSS ile Veri Analizi. Ankara: Nobel Publications.

Temiz, T. (2012). “Sınıf Öğretmeni Adaylarının Matematik Öğretimine Yönelik Öz-Yeterlik Algıları İle Kaygıları Arasındaki İlişki.” Published Master’s Thesis. Yüzüncü Yıl University, Institute of Natural Sciences, Van.

Tschannen-Moran M, Woolfolk-Hoy A. (2001). Teacher efficacy: Capturing an elusive concept. Teaching and Teacher Education, 17, 783-805.

Tschannen-Moran, M., Woolfolk Hoy, A., & Hoy, W. K. (1998). Teacher efficacy: Its Meaning and measure. Review of Educational Research, 68(2), 202-248.

Turanlı, N., Türker, K. N., & Keçeli, V.(2008). Matematik alan derslerine yönelik tutum ölçeği geliştirilmesi. Hacettepe University Journal of Education, 34, 254-262.

Türkmen, L. & Bonnstetter, R. (1999). A study of Turkish preservice science teachers’ attitudes toward science and science teaching. Paper presented at the annual convention of National Association of Research in Science Teaching. Boston, MA.

Wellington, J. (1998). Practical Work In Science: Time For Reappraisal. In J. Wellington (Eds.). Practical Work in School Science, Which Way Now? (3-15). London and Newyork: Routledge.

Yener, D., Aydın, F., & Köklü, N. (2012). Genel fizik laboratuvarındaki öğrencilerin fiziğe karşı öz-yeterliklerine animasyon ve simülasyonun etkisi. Abant İzzet Baysal Üniversitesi Eğitim Fakültesi Dergisi, 12(2), 121-136.

Yeşilyurt, M. (2003). Yükseköğretim temel fizik laboratuvar uygulamalarında bütünleştirici yaklaşım. Published Doctoral Dissertation, Karadeniz Technical University Institute of Natural Sciences, Trabzon.

Yılmaz, M., Köseğlu, P. Gerçek, C. & Soran, H.(2004b) “Yabancı dilde hazırlanan bir öğretmen öz-yeterlik ölçeğinin Türkçe” ye uyarlanması“ VI. National Science and Mathematics Education Congress,  İstanbul: Marmara University, 9-11 September 2004.

Babanskiy, Yu.K. (1982). Optimizatsiya uchebno-vospitatelnogo protsessa. Moskva, p. 192.

Bim-Bad, B.M. (2003). Pedagogicheskiy entsiklopedicheskiy slovar. Moskva: Bolshaya Rossiyskaya entsiklopediya, p. 192.

Chaklikova, A.T. (2007). Kategorii “competentnost” i “kompetentsiya” v sovremennoy obrazovatelnoy paradigm. Vestnik KazNU. Seriya pedagogicheskie nauki, 2, 9-16.

Curren, R. (2007). Philosophy of education: an anthology. Malden, MA: Blackwell Pub., p. 582.

Felder, R.M., Silverman, L.K. (1988). Learning and Teaching Styles In Engineering Education. Engr. Education, 78, pp. 674–681.

Flinders, D.J., Thornton, S.J. (2004). The curriculum studies reader. New York, NY: RoutledgeFalmer, p. 355.

Hansen, D.T. (2007). Ethical visions of education: philosophies in practice. New York, NY: Teachers College Press, p. 212.

Kendall, J.C. (1990). Combining Service & Learning: A Resource Book for Community and Public Service. Raleigh: National Society for Internships and Experiential Education

Makhmutov, M.I. (1975). Problemnoe obuchenie: Osnovnye voprosy teorii. Moskva: Pedagogika, p. 368.

Matyushkin, A.M. (1972). Problema situatsii v myshlenii i obuchenii. Moskva: Pedagogika.

Monoszon, E.I. (1981). K problematike issledovaniy po metodologii pedagogiki. Sovetskaya pedagogika, 12, 13-15.

Monoszon, E.I. (1986). Osnovy pedagogicheskikh znaniy. Moskva: Pedagogika, p. 199.

Pidkasistyy, P.I. (1980). Samostoyatelnaya poznavatelnaya deyatelnost shkolnikov v obuchenii. Teoriya eksperimentalnogo issledovaniya. Moskva: Pedagogika, p. 240.

Rysbaeva, A.K. (2003). Uspechnost deyatelnosti kak kategoriya pedagogiki. Almaty, KNPU im. Abaya, p. 266.

Satybaldina, K., Tarasenko, R. (1991). Problemnoe obuchenie kak osnova formirovaniya tvorcheskogo myshleniya studentov. Alma-Ata: Kazak universiteti, p. 16.

Selinger, E., Crease, R.P. (2006). The philosophy of expertise. New York: Columbia University Press, p. 421.

Sokolnikov, Yu.P. (1986). Sistemnyy analiz vospitaniya shkolnikov. Moskva: Pedagogika, p. 137.

Spirkin, A.G. (1979). O tvorcheskoy sile chelovecheskogo razuma, Moskva: Progress, p. 352.

Spirkin, A.G. (1988). Osnovy filosofii. Uchebnoe posobie dlya vuzov. Moskva: Politizdat, p. 592.

Tarasenko, R. (2003). Pedagogika. Kurs lektsiy. Almaty, p. 229.

Ushakov, D.V. (2004). Sotsialnyy intellect kak vid intellekta. Sotsialnyy intellect: teoriya, izmerenie, issledovaniya. Moskva: Institut psikhologii RAN, pp. 11-29..

Ananiev B.G. (2001). Psychology of emotional learning. Nauka, Moscow, ISBN: 5-02-013093-1

Bakushinsky A.V. (2009). Creative art and education. Karapuz, Moscow, ISBN: 978-5-8403-1522-4

Davydov, V.V., Kudriavtsev V.T. (1997). Developmental education: theoretical foundation of succession of preschool and elementary stages. Issues of psychology, № 1, Moscow, no ISBN

Zaporozhets, A.V. (1986). Selected psychological works. V.V. Davydov, V.P. Zynchenko (edit.), 2 vol. Pedagogics, Moscow, no ISBN

Kapterev, P.F. (1982). Selected pedagogical works. Pedagogics, Moscow, no ISBN

Likhachyov, D. (1991). Book of worries. Novosti, Moscow, no ISBN

Mukhina, V.S. (2000). Developmental psychology: phenomenology of development, childhood, adolescence. Academia, Moscow, ISBN: 5-7695-0408-0

Prishvin, M.M. (1983). Collected works in 8 volumes. Volume 7. Khudozhestvennaya literatura, Moscow, no ISBN

Soloviev, S.M. (1997). Vladimir Soloviev. Life and creative evolution. Respublika, Moscow, ISBN 5—250—02597—8

Flerina, E.A. (1928). Material environment and preschooler. Art in school, № 1, Moscow, no ISBN

Froebel, F. (1923). Pedagogical works. Volume 1. Upbringing. Publishing house of K.I. Tikhomirov, Moscow, no ISBN

Hannaford, K. (1995). Wise movement: we learn not only with our head, translated by A.V. Samarova and S.K. Masgutova. Pedagogics, ISBN: 5-93187-008-3

Shkolyar, L.V., Savenkova, L.G. (2012). GARDEN OF CHILDHOOD, new model of preschool education. Russkoye slovo. Moscow, ISBN: 978-5-91218-268-6.

1. Allen, B., Timmer, S.G., Urquiza, A.J. (2014). Parent–Child Interaction Therapy as an attachment-based intervention: Theoretical rationale and pilot data with adopted children // Children and Youth Services Review. V.47. P. 334-341.
2. Barabanova, V.V. (1995). Knowing the difficulties in child development and learning to overcome them. Family orphanage: reality, problems and perspectives in modern Russia. Moscow: House (25–26).
3. Bobkin, A.E. (1998). Foster family: psychological diagnostic a prospective parent. Family in Russia. 3-4. (97-111).
4. Bolshakova, L.N. (2004). Social-psychological adaptation of parents and children in a foster family. (Master’s thesis), Yaroslavl.
5. Brown, J.D., Anderson, L., Rodgers, J. (2014). Needs of foster parent resource workers // Children and Youth Services Review. V.46. P. 120-127.
6. Chernyshova, L.A. (2004). Social and psychological adaptation of a child in a foster family and assistance in psychological correction to foster families.  (Master’s thesis), Samara.
7. Chiara Berti, L.P. (2009). Different ecological perspectives for evaluating residential care outcomes: Which window for the black box? Children and Youth Services Review. Vol. 31, 10, pp. 1080-1085.
8. Cooley, M.E., Petren, R.E. (2011). Foster parent perceptions of competency: Implications for foster parent training // Children and Youth Services Review. V.33. P. 1968-1974.
9. Dubrovina, I.V., Ruzskaya, A.G. (editor.) (1990). Psychic development of children from orphanage. M.: Pedagogy.
10. Eidemiller, E.G., Dobryakov, I.V., & Nikolskaya, I.M. (2005). Family diagnosis and family psychotherapy. St. Petersburg, Rech Publ.
11. Eidemiller, E.G., & Yustitskis, V.V. (2002). Psychology and psychotherapy of a family. St. Petersburg, Piter Publ.
12. Ivanova, M.V. (2007) Social-pedagogical rehabilitation of orphans in a foster family. (Doctoral dissertation). Saint Petersburg
13. Ivanova, N.P. (2008) Social adaptation of children in a foster family. Family in Russia. 2. (59-65).
14. Johnson, R., Browne, K.D. and Hamilton-Giachritsis, C.E. (2006). Young children in institutional care at risk of harm. Trauma Violence Abuse. 7. (34-60).
15. Karabanova, O.A. (1998) Projective technique “Parent’s essay” in psychological counselling. Family psychology and family therapy. 1. (59-73).
16. Kholmogorova, A.B. (2002). Scientific basis and practical tasks of family psychotherapy. Moscow psycho-therapeutical journal. 1. (93-119).
17. Khrustalkova, N.A. (2007). System of complex supervision of a professional foster family. Pedagogy. 2. (52-58).
18. Langmeier, J., & Matějček, Z. (2011) Psychická deprivace v dětstvi. Praha: Karolinum.
19. Leathers, S.J., Spielfogel, J.E., Gleeson, J.P., Rolock, N. (2012). Behavior problems foster home integration, and evidence-based behavioral interventions: What predicts adoption of foster children? // Children and Youth Services Review. V.34. P. 891-899.
20. Liders, A.G. (2008) Psychological exam of a family. Moscow: Akademiya Publ.
21. Lisina, M.I. (1986) Problems of ontogenesis of communication. Мoscow: Pedagogika Publ.
22. Minevich, O.K. (2009) Social and psychological conditions of adaptation of children in foster families. (Master’s thesis), Tambov.
23. Markovskaya, I.M. (2000) Training of interaction of parents and children. St. Petersburg: Rech Publ.
24. Minuchin, P., Brooks, A., Colapinto, J., Genijovich, E., Minuchin, D., Minuchin, S. (1990). Training Manual for foster parents based on an ecological perspective on foster care. New York: Family Studies.
25. Minuchin, S. (1974). Families and family therapy. Cambridge, MA: Harvard University Press.  
26. Mukhina, V.S. (1989) Psychological help to children who live in orphanages. Questions of psychology. 1. (32-39).
27. Nissim, R. (1997). Children living in substitute families: Historical perspectives on family placement: Patronage or partnership? Oxfordshire Social Services, England UK // Educational and Child Psychology. V.14 (2). P. 4-12.
28. Ovcharova, R.V. (2003). Psychological supervision of parenthood. Moscow: Institute of Psychotherapy Publ.
29. Oliferenko, L.Y. (2003). Foster family is an institute of childhood protection. Recommendations to a social pedagogue Social pedagogy. 2. (77-88).
30. Osipova, I.I. (2002). Foster family as a forming social institute. (Master’s thesis), Мoscow.
31. Osipova, I.I. (2009). Phenomenon of the second orphanhood in modern Russia. Orphanage. 1 (30). (14-19).
32. Oslon, V.N. (2006). Placement of orphans: professional foster family. Moscow: Genesis.
33. Oslon, V.N., & Kholmogorova, A.B. (2001). Psychological supervision of foster professional family. Questions of psychology. 4. (39-52).
34. Palieva, N.A. (2008). Upbringing and development of personality of orphans in alternative forms of family placement (Doctoral dissertation) Stavropol.
35. Prikhozhan, A.M., & Tolstykh, N.N. (2007). Psychology of orphanhood. Moscow: National fund of child protection from violence.
36. Semya, G.V. (2004). Foundations of psychological security of children without parental care (Doctoral dissertation), Moscow.
37. Semya, G.V., Zaitsev, G.O., & Zaitseva, G.O. (2009). Monitoring of orphans and children without parental care, and development of family forms of their placement in Central Federal District in 2008. Moscow: Variant Publ.
38. Shipitsina, L.M. (2005). Psychology of orphans. St Petersburg, University of St. Petersburg Publ.
39. Spivakovskaya, A.S. (1991). Psychological help to the families who took children from state establishments for upbringing. In V.S. Mukhina Reader: Deprived of parental care. (pp. 127-132). Moscow, Prosveshcheniye.
40. Spivakovskaya, A.S. (1999). Psychotherapy: game, childhood, family. Moscow, EKSMO-press.
41. Storer, H.L., Barkan, S.E., Sherman, E.L., Haggerty, K.P., Mattos, L.M. (2012). Promoting relationship building and connection: Adapting an evidence-based parenting program for families involved in the child welfare system // Children and Youth Services Review. V.34. P. 1853-1861.
42. Ternovskaya, M.F. (2004). Pedagogical basics of adaptation of children – social orphans in the system of patronizing upbringing. (Master’s thesis). Moscow.
43. Ushakova, E.V. (2003). Social and psychological abilities of a foster family as a rehabilitation structure for orphans. (Master’s thesis). Moscow.
44. Varga, A.Y. (2001). Systematic family psychotherapy: Brief lecture course. SPb.: Speech.
45. Zakharova, Zh.A. (2009). Social and pedagogical supervision of the process of upbringing of a foster child in a foster family. (Doctoral dissertation). Kostroma.
46. Zernitskiy, O.B. (2002). Motives of adoption and peculiarities of parental positions in families with foster children. Bulletin of psycho-social and correctional-rehabilitation work. 1. (45-50).

Abolin, L.M. (1989). Emotsionalnaya ustoychivost i puti ee povysheniya. [Emotional stability and ways of its increase]. Voprosy psikhologii, 4, 141-149.

Alekseeva, E.V. (2003). Psikhologicheskie osnovy tolerantnosti uchetelya. [Psychological bases of a teacher’s tolerance]. Monology ob uchitele. (Eds. V.Yu. Krichevskiy, E.V. Lyulikova). SPb.: APPO, pp. 165-177.

Allport, G. (2002). Stanovlenie lichnosti: Izbrannye Trudy. [Establishment of a personality: Selected works]. M.: Smysl, 462 p.

Asmolov, A.G. (1998). Tolerantnost: razlichnye paradigmy analiza. [Tolerance: different paradigms of analysis]. Tolerantnost v obschestvennom soznanii Rossii. M.: Smysl, 246 p.

Bardier, G.L. (2005). Sotsialnaya psikhologiya tolerantnosti. [Social psychology of tolerance]. SPb.: Izd-vo S-Pererb. un-ta, 119 p.

Baron, R. Carr, N., Miller, N. (2003). Sotsialnaya psikhologiya gruppy: protsessy, resheniya, deystviya: Monografiya. [Social psychology of a group: processes, solutions, actions: Monograph]. SPb.: Piter, 272 p.

Belasheva, I.V. (2014). Tolerantnoe povedenie kak kriteriy psikhologicheskogo zdoroviya lichnosti. [Tolerant behavior as a criterion of personality mental health]. Mir nauki, kultury, obrazovaniya, 6, 243-244.

Berry J., Purtinga, A., Seagull, M., Dusen, P. (2007). Kross-kulturnaya psikhologiya. Issledovaniya i primenenie. [Cross-cultural psychology. Studies and implementation]. Kharkov: Gumanitarnyy Tsentr, 518 p.

Bondyreva, S.K., Kolesov, D.V. (2003). Tolerantnost: vvedenie v problemu. [Tolerance: introduction to the problem]. M.: MPSI; Voronezh: MODEK, 240 p.

Dyachenko, M.I., Ponomarenko, V.A. (1990). O podkhodakh k izucheniyu emotsionalnoy ustoychivosti. [On the approaches towards studying emotional stability]. Voprosy psikhologii, 1, pp. 106-113.

Eriksson, E. (2000). Detstvo i obschestvo. [Society and childhood]. SPb.: Rech, 416 p.

Eyesenk, H., Wilson, H. (2010). Kak izmerit lichnost. [How to measure personality]. M.: Kogito-Tsentr, 284 p.

Festinger, L. (1999). Teoriya kognitivnogo dissonansa. [Theory of cognitive dissonance]. (Translated from English). SPb.: Yuventa, 317 p.

Fetiskin, N.P., Kozlov, V.V., Manuylov, G.M. (2005). Sotsialno-psikhologicheskaya diagnostika razvitiya lichnosti I malykh grupp: uchebnoe posobie. [Social-psychological diagnostics of the development of personality and small groups: textbook]. M.: Izd-vo Instituta Psikhoterapii, 490 p.

Freud, S. (1998). Massovaya psikhologiya I analiz chelovecheskogo “Ya”. [Mass psychology and analysis of human “Self”]. Samara: Izdatelskiy Dom “BAKHRAKH”, 592 p.

Grinshpun, I.B. (2002). Ponyatie i soderzhatelnye kharakteristiki tolerantnosti (k voprosu o tolerantnosti kak psikhicheskom yavlenii). [The concept and essential characteristics of tolerance (to the question of tolerance as a psychological phenomenon)]. Tolerantnoe soznanie i formirovanie tolerantnykh otnisheniy (teoriya i praktika): sb. nauch. – metod. st. M: Izd-vo MPSI; Voronezh: Izd-vo NPO “MODEK”, pp. 31-42.

Gurieva, S.D. (2009). Mezhetnicheskie otnosheniya i konflikt. [Inter-ethnic relations and conflict]. SPb.: Nestor-Istoriya, 366 p.

Horney, K. (2007). Nashi vnutrennie konflikty. [Our internal conflicts]. M.: Akademicheskiy proekt, 224 p.

Ilyin, E.P. (2001). Emotsii i chuvstva. [Emotions and feelings]. SPb.: Piter, 752 p.

Jeffries, E.R., McLeish, A.C., Kraemer, K.M., Avallone, K.M., Fleming, J.B. (2015). The Role of Distress Tolerance in the Use of Specific Emotion Regulation Strategies. Behavior Modification, 40(3), 439-451.

Komlev, N.G. (2000). Slovar inostrannykh slov. [Dictionary of foreign words]. M.: EKSMO-Press, 672 p.

Krupnik, E.P. (1997). Psikhologicheskaya ustoychivost lichnosti kak metodologicheskaya problema. [Psychological stability of a personality as a methodological problem]. Nauchnye Trudy Moskovskogo pedagogicheskogo gosudarstvennogo universiteta im. V.I. Lenina. (Ed. V.L. Matrosov et al.). M.: Prometey, pp. 270-278.

Kruskal, W.H., Wallis, W.A. (1952). Use of ranks in one-criterion variance analysis. Journal of the American Statistical Association, 47(260), pp. 583-621.

Kulikov, L.V. (2001). Psikhicheskie sostoyaniya. Khrestomatiya. [Mental states. Anthology]. SPb.: Piter, 512 p.

Laposa, J.M., Collimore, K.C., Hawley, L.L., Rector, N.A. (2015). Distress tolerance in OCD and anxiety disorders, And its relationship with anxiety sensitivity and intolerance of uncertainty. Journal of Anxiety Disorders, 33, 8-14

Lebedeva, N.M. (1999). Vvedenie v etnicheskuyu i kross-kulturnuyu psikhologiyu: uchebnoe posobie. [Introduction to ethnic and cross-cultural psychology: textbook]. M.: Klyuch +C, 191 p.

Lektorskiy, V.A. (1997). O tolerantnosti, plyuralizme i krititsizme. [On tolerance, plurality and criticism]. Voprosy filosofii, 11, 46-54.

Matsumoto, D. (2002). Psikhologiya i kultura. Sovremennye issledovaniya. [Psychology and culture. Current studies]. SPb.: Praim-Evroznak, 416 p.

Moscovici, S. (1984). Obschestvo i teoriya v sotsialnoy psikhologii. Sovremennaya zarubezhnaya sotsialnaya psikhologiya. [Society and theory in social psychology. Current international social psychology]. (Eds. G.M. Andreeva, N.N. Bogomolov, L.A. Petrovskaya). M.: MGU, pp. 208-228.

Nicklson, P. (2001). Tolerantnost kak moralnyy ideal. [Tolerance as a moral ideal]. Vestnik Uralskogo mezhregionalnogo instituta obschestvennykh nauk, 1, 58-67.

Nikiforov, G.S. (2006). Psikhologiya zdorovya: uchebnik dlya vuzov. [Psychology of health: textbook for colleges]. (Ed. G.S. Nikiforov). SPb.: Piter, 607 p.

Petrova, N.F. (2015). Psikhologicheskaya zaschita kak sredstvo obespecheniya bezopasnosti lichnosti i sohraneniya psikhicheskogo zdorovya. [Psychological defense as a tool for providing safety of a personality and preserving mental health]. Mir nauki, kultury, obrazovaniya, 5(54), pp. 132-133.

Pochebut, L.G. (2007). Vzaimoponimanie kultur: Metodologiya i metody etnicheskoy i krosskulturnoy psikhologii. Psikhologiya mezhetnicheskoy tolerantnosti: uchebnoe posobie, 2-e izd. [Mutual understanding of cultures: Methodology and methods of ethnic and cross-cultural psychology. Psychology of inter-ethnic tolerance: textbook, 2nd edition]. SPb.: SPbGU, 281 p.

Richardson, D., Baron, R. (2001). Agressiya. [Aggression]. (Translated from English by S. Melenevskaya, D. Viktorova, S. Shpak). SPb.: Piter, 352 p.

Rogers, C. (1961). On becoming a person. Boston: HoughtonMifflin.

Romek, V.G. (2003). Trening uverennosti v mezhlichnostnykh otnosheniyakh. [Training of confidence in interpersonal relationships]. SPb.: Rech, 175 p.

Sirotin, O.A. (1973). K voprosu o psikhologicheskoy prirode emotsionalnoy ustoychivosti sprtsmenov. [On the question of the psychological nature of emotional stability in athletes]. Voprosy psikhologii, 1, pp. 129-132.

Skinner, B. (1953). Science and Human Behavior. New York: Macmillan.

Soldatova, G.U. (2012). Praktikum po psikhodiagnostike I issledovaniyu tolerantnosti lichnosti. [Practicum in psychological diagnostics and evaluation of personality tolerance]. M.: Izd-vo MGU im. M.V. Lomonosova, 112 p.

Stakhneva, I.Yu. (2005). Psikhologicheskaya ustoychivost lichnosti. [Psychological stability of a personality]. Mentalnost rossiyskoy provintsii v nastoyaschem i buduschem: Sbornik nauchnykh statey. Samara: Izd-vo “Samara”, pp. 95-111.

Stefanenko, T.G. (2009). Etnopsikhologiya: Uchebnik dlya vuzov. [Ethnopsychology: Textbook for colleges]. 4-e izd., ispr. i dop. M.: Aspekt Press, 368 p.

Tajfel, H. (1982). Sotsialnaya identichnost i mezhgruppovye otnosheniya. [Social identity and between-group relationships]. M.: Moskva.

Turner, J. (2003). Sotsialnoe vliyanie. [Social influence]. SPb.: Piter, 224 p.

Vardanyan, B.Kh. (1983). Mekhanizmy regulyatsii emotsionalnoy ustoychivosti. [Mechanisms of emotional stability regulation]. Kategorii, printsipy i metody psikhologii, Psikhicheskie protsessy. M.: Nauka, pp. 542-543.

Walzer, M. (2000). O terpimosti. [On tolerance]. (Translated from English by I. Myurnberg). M.: Ideya-Press, Dom intellektualnoy knigi, 160 p.

Zilberman, P.B. (1974). Emotsionalnaya ustoychivost operatora. [Emotional stability of an operator]. Ocherki psikhologii truda operatora. (Ed. E.A. Mileryan). M.: Nauka, pp. 138-172.

1. Pischulin N.P. (2002). Formirovat, vospityvat dukhovnost uchaschikhsya [Forming, educating the spirituality of students], Pedagogika tolerantnosti [Pedagogics of tolerance]. № 3.
2. Chistyakov V.V. (1999). Antropologo-metodologicheskiye osnovy pedagogiki [Anthropological and methodological foundations of pedagogics]. Yaroslavl: Publishing house of Yaroslavl State Pedagogical University named after K.D. Ushinsky.
3. Rozin V.M. (1996). Predmet i status filosofii obrazovaniya [Subject and status of philosophy of education] // Filosofiya obrazovaniya: Collected articles [Philosophy of education: Collected articles] / Publishing editor A.N. Kochergin. – M.: Fond “Novoye Tysyacheletiye”.
4. Gusinski E.N. (2000). Vvedeniye v filosofiyu obrazovaniya: textbook [Introduction to philosophy of education: textbook]. – M.: Folio.
5. Gusinski E.N., (2000). Turchaninova Yu. I. Vvedeniye v filosofiyu obrazovaniya [Introduction to philosophy of education]. — M.: Publishing corporation “Logos”,
6. Schitov S. B. (2007). Filosofiya obrazovaniya: textbook [Philosophy of education: textbook]. – M: Shkola-Press,
7. Rozin V.M. (2007). Filosofiya obrazovaniya: Etyudy-issledovaniya [Philosophy of education: Research essays. M: Publishing house of Moscow Psychology and Sociology Institute; Voronezh: Publishing house NPO “MODEK”,
8. Bim-Bad B.M. (2009). Filosofsko-pedagogicheskiye osnovy sovremennykh obrazovatelnykh praktik [Philosophical and pedagogical foundations of modern educational practices] //Obrazovaniye i obschestvo [Education and society] № 3. P. 100-104.
9. Kraevsky V.V. (2002). Metodologiya pedagogiki: proshloye i nastoyascheye [Methodology of pedagogics: the past and the present], Pedagogika [Pedagogics]. № 1. P. 3-10.
10. Voronovich B.A. (1972). Filosofsky analiz struktury praktiki [Philosophical analysis of practice structure]. - M .: Mysl, - 280 p.
11. Klimov A.V. (1991). Dialektika i praktika [Dialectics and practice]. - M .: Vyschaya shkola, - 144 p.
12. Simonyan E.A. (2000). Edinstvo teorii i praktiki: Filosofsky analiz [Unity of theory and practice: Philosophical analysis]. – M.
13. Kremen V.G., Gorlach M.I. (2004). Filosofiya: textbook for higher school [Philosophy: textbook for higher school]. - M .: Znamya.
14. Chapayev N.K. (2013). Filosofiya i istoriya obrazovaniya [Philosophy and history of education]. M.: Publishing house: Academia.
15. Stepashko L.A. (1999). Filosofiya i istoriya obrazovaniya [Philosophy and history of education]. - M.: Publishing house Flinta.
16. Kokhanovsky V.P. (1999). Filosofiya i metodologiya nauki: textbook for universities [Philosophy and methodology of science: textbook for universities]. Rostov-on-Don: Feniks,
17. Rodionova I.A. (2000). Sovremennaya amerikanskaya filosofiya obrazovaniya i vospitaniya: tematicheskiye polya i paradigmalno-contseptualnye postroyeniya [Modern American philosophy of education: thematic fields and paradigm-conceptual structures]. Moscow
18. Bim-Bad B.M. (2005). Pedagogicheskaya antropologiya. Vvedeniye d nauchnuyu i obschekulturnuyu diskussiyu o cheloveke kak vospitatele i vospituemom, o putyakh yego samosovershenstvovaniya [Pedagogical anthropology. Introduction to scientific and general discussion about a man as an educator and educatee, about lines of his self-improvement]. Moscow: RAO (Russian Academy of Education).

1. Baydenko, V. I. (2005). Competence approach to the design of the state educational standards of higher professional education (methodological and methodical questions): Manual. 2nd ed. - M.: Research center of training quality problems, - 114 p.

2. Budkeev, S. M. (2002). Analysis of psychological readiness of pedagogical high school students to the perception of organ music, Pedagogical education in Altai, 1, 18-22.

3. Bystrova, T. Y. (2001). A thing. A form. A style: An Introduction to design philosophy. Ekaterinburg: Publishing House of the Ural University,  288 p.

4. Guryev, A. I. (2002). Status of intersubject communications in the system of modern education, Science and School, 2, 41-45.

5. Gladyshev, G. M. (2014). Art education as a continuous process of formation of the designer personality: Materials of All-Russian Scientific Conference. - Orenburg: IPK «University», pp. 414-421.

6. Zimnaya, I. A. (2003). Key competencies - the result of a new paradigm of education, Higher education today, 5, 34-42.

7. Ikonnikov, A. I. A systematic approach to the theory and practice of teaching academic drawing in the art-graphic faculties of pedagogical institutes. - Khabarovsk: Publishing house KhSPU, 1998. - 160 p.

8. Karnaev, M. A. (2011). Design students training to design activity in the early stages of painting education // The world of science, culture and education, Gorno-Altaisk, 4(1), 156 -157.

9. Kenzhebekov, B. T. (2004). Methodological approaches to the study of the expert professional competence development, Vocational Education, 5, 177-182.

10. Kiryushina, Y. V. (2011). Intangible cultural heritage - the current concept of modernity, News of Altai State University, 2(1), 244-247.

11. Kiseleva, N. E., Shokorova, L. V. (2014). Decorative composition as a means of designers' creative thinking development // Historical, philosophical, political and juridical sciences, cultural studies and art history. Questions of theory and practice. Tambov: Publishing House of the “Charter” -  9 (47), 203-205.

12. Mazin, Y. I., Kamzina, N. E. (2013). Methods for solving design problems in the design, Fundamental Research, 11(9), 1941-1945.

13. Minervin, G. B., Shimko, V. T., Efimov, A. V., Ermolaev, A. P. et al. (2004). Design. The main statutes. Design Types. Features of design projecting. Masters and theorists. Illustrated Dictionary. - M., 320 p.

14. Novikova, Y. V. (2008). Propaedeutic approach to multilevel designers' training, News of Yaroslav the Wise Novgorod State University, 48, 42-45.

15. Sokolnikova, N. M. (2008). Traditions and innovations of high school designers training, Pedagogical Bashkortostan journal, 5, 19-80.

16. Ustin, V. B. (2007). Composition in design. Methodical bases of composition-artistic form making in design creativity: Teaching guide. - M.; AST: Astrel, 239 p.

17. Chizhikov, V. V. (2005). Cultural values regulations in the design, Bulletin of Moscow State University of Culture and Arts, 3 (12), 59-65.

18. Fedoretc, G. F. (1983). Interdisciplinary communications in the learning process. - L.; Herzen LGPI,  83 p.

19. Shilova, N. V., Lesnevskaya, T. I., Baeva, O. V. (2012). Arts (architecture and decorative arts of the peoples of the North Caucasus and the Don). - Rostov-on-Don. 187 p.

20. Yakushev, M. S. (2009). Transformation of natural motif into the ornamental decorative form: Teaching Guide - M.: Stroganov MGHPU, 240 p.

21. Shokorova, L.V., Turlyun, L.N. The Problem of Synthesis of Traditions and Innovations in the Art of Woodwork. World Applied Sciences Journal 27 (3): 408-412, 2013.

22. Shokorova, L.V., Turlyun, L.N. (2016). Shaping of Arts and Crafts Objects Using Computer Graphics. International Journal of Applied Engineering Research, 11(4), 2185-2190

23. Chernyaeva, I.V. (2014). Sources of funding of cultural institutions in Russia at the turn of the XX - XXI centuries. Terra Sebvs. Special Issue. 147-159.

24. Nekhvyadovich L.I., Chernyaeva I.V. (2016). Experience and Perspectives of Art History Development in Educational Space of Siberia at the Turn of XX – XXI centuries. International Journal of Environmental & Science Education, 11(79, 1501-1507.

Bourdieu, P. (2005) Sotsiologia sotsialnogo prostranstva [Sociologie de l`espace social]. Moscow: Institut eksperimentalnoy sotsiologii, St Petersburg: Aleteya.

Filipova A.G. (2012) Sotsialnoye neravenstvo detstva v gorodskoy srede (na primere g. Komsomolska-na-Amure) ([Social Inequality of Children in Town Space (Case Study: the City of Komsomolsk-on-Amur)]. Uchenye zapiski Komsomolskogo-na-Amure gosudarstvennogo technicheskogo universiteta. Nauki o cheloveke, obshchestve i culture, 2: 67-75

Filippov A.F. (2008) Sotsiologia prostranstva [Spacial Sociology], St Petersburg: Vladimir Dal

Goffman E. (2000) Predstavlenye sebya drougim v povsednevnoy zhizni [The Presentation of Self in Everyday Life], Moscow, Canon-Press-tz

Jacobs J.  (2011) Smert i zhizn bolshikh amerikanskikh gorodov [The Death and Life of Great American Cities], Moscow: Novoye Izdatelstvo

Naberushkina E.K. (2011) Gorod dlya vsekh: sociologichesky analiz dostoupnosti gorodskogo prostranstva dlya invalidov [A town for Everybody: sociological analysis of availability of Town Areas for Disabled People], Sotsiologiya goroda, 3: 119-139.

Osorina M.V. (2000) Sekretniy mir detei v prostranstve vsroslykh [The Secret World of Children in the Adult World], St Petersburg: Peter

Voronkova L., Pachenkov O. (ed.) (2014) SAGA o gorode. Transformatsiya obshchestvennykh prostranstv. [City SAGA. Transformation of Public Areas.], St Petersburg: NP-Print.

Ward C. (1978). The child in the city York.

1. Lagodina E.V., (2012). Architecture as text. Semiotics analysis of architectural space, North Caucasian psychological messenger, 2(10), 47-49.
2. Molozhavenko V. L., (2006). Technology of competence-based approach in system of higher education, Science and school, 4, 6-9.
3. Serkova V.A., (2011). Problems of arts education at polytechnical university (materials of a round table), Works Sankt-of the St. Petersburg state polytechnical university of Peter the Great, St. Petersburg, 513, 3 - 22.
4. Petrov V.V., (2012). Integration of science and education in the conditions of modernization of the Russian society, Education Philosophy, 1(40), 64-70.
5. Yelizarova G.V., (2010). To new education new system of educational values, Universum: Bulletin of Gertsenovsky university, 9, 14 - 17.
6. Hanzhina T.V., (2015). An education role in modern society, Modern high technologies, 12(5), 947-950.
7. Yakimanskaya I.S., (2010). The concept of personally focused education, Scientific notes of Petrozavodsk state university, 5, 36 - 40.
8. Bakuradze A.B., (2013). Classification of values in the context of management of education, Science and education, 7(106), 101-113.
9. Traynev V.A., (2013). New information communication technologies in education, Moscow, p.p. 320.
10. Kiryakova A.V., Moroz V.V., (2015). The interaction of valuable orientations and creativity as axiological resource of modernization of university education, Bulletin of the Chelyabinsk state pedagogical university, 1, 57-68.
11. Pchelintseva I.G., (2012). Pedagogical conditions of formation of tolerance in the conditions of a modern sociocultural situation, Regional formation of the 21st century: problems and prospects, 5, 305-309.
12. Alpin G., (2007). World Heritage Cultural Landscapes, Internacional Journal of Heritage Studies, 13(6), 427-446.
13. Korneenkov S.S., (2005). Education – human value: an assessment of quality of education and a role of the personality in education, TGEU Bulletin, 4, 1-6.
14. Dmitriyev L.M., Balyuta P.A., (2015). Total design of modern sociocultural space, Omsk scientific bulletin, 2(136), 87-88.
15. Loyfman I.YA., (2002). World outlook studies, Yekaterinburg: Bank of cultural information, 100.
16. Gram G., (2004). Art Philosophy, M.: Word, p.p. 256.
17. Kagan M., (1972). Art Morphology: historical and theoretical research of an internal structure of the world of art, Leningrad: Art, p.p. 426.
18. Eco U., (2006). Absent structure. Introduction into semiology, St. Petersburg: Symposium, p.p. 432.
19. Branskiy V. P., (1999). Art and philosophy: a role of philosophy and formation and perception of a work of art on the example of painting history, Kaliningrad: Amber narration, p.p. 704.
20. Berger, L.G., (1997). Epistomology of art, Moscow: Russkiy mir, p.p. 432.

Baidenko V. I. (2006) Determination of composition of graduate competences as a necessary stage of designing of new generation GOS VPO: Methodical manual. - 55 p.

Baker M. J. (2014) Writing a Literature Review. Terra economicus. Issue 3 / volume 12

Bordovskaya N.V. (2009) Educational systemology: a tutorial. M. Drofa. 464 p.

 “Education Law” of the Republic of Kazakhstan. Astana, 2010. - URL: <http://www.edu.gov.kz/>

Glossary of terms Bologna process. URL: uchkom.info"index.php...

Krajewski V. V. (2006).Methodology of pedagogy: new stage: a textbook for students of higher educational institutions. - M., Publishing center "Akademiya",. 400 p.

Kusainov A. (2013).The quality of education in the world and in Kazakhstan. - Almaty, - 196 p.

Levenchuk D. V. Methods of experimental work in the study of the continuity of professional education// World of science, culture, education. # 4, 2012

Nabi Y. (2014).The quality assurance systems in higher education: Designing on the basis of the EFQM model: Monograph. - Deutschland, Saarbrucken, Palmarium Academic Publishing. 201 p.

National reports on the condition and development of education, (2014). Compilers: A.Kultumanova, G.Nogaybaeva, G.Kusidenova, B.Kabatova and others.- National Center for Education Statistics and Evaluation. -Astana. 292 p.

Novikova T. G. (2002).Design experiment in education systems. – M.:APK&PRO. -112 p.

Shekerbekova L. (2006).National-oriented education as the basic idea of education reform in Kazakhstan // Ulttagylymy, #1

Subetto A. I., Selezneva N. A. (2001).Theoretical and methodological basis of the quality of higher education. – SPb.-M.: ICPPS. – 136 p.

Teslinov A. G. (1998).Development of control systems: methodology and conceptual structures. – M.: Globe. – 229 p.

Taubaeva Sh. T. (2013).Methodology of pedagogy: a tutorial. Almaty, “Karasay”. 432 p.

Yakovlev E. V. (2000).Theory and practice of education quality management in University: Dis.... doctor. ped. Sciences. – Chelyabinsk, – 418 p.

1. Anufrieva, N.I., et al. (2015). Formation of a Modern Musician’s Personality in Educational Environment of a Higher Education Institution: Complex Approach.  Asian Social Science; Vol. 11(6), 13-18, doi:10.5539/ass.v11n6p13.
2. Astafyev, B.V.  (1955). Russkaya musyka o detyakh i dlya detey [Russian music about children and for children].  Izbrannye trudy. [Selected works]. V. IV. Moscow. P .97-109.
3. Vershinina, I.Y. (1959). Rechevaya vyrazitelnost melodiki Mussorgskogo [Vocal expressiveness of Mussorgsky`s melodics].  Sovetskaya muzyka. #7. P. 71-80.
4. Golenishchev-Kutuzov, A.A. (1989). Vospominaniya o Mussorgskom.  [Reminiscences of Mussorgsky]. Mussorgsky v vospominaniyakh sovremennikov [Mussorgsky in his contemporaries` reminiscences]. Moscow. P. 132-152.
5. Golovinvky, G.L.; Sabinina, M.D. (1998). Modest Petrovich Mussorgsky. Moscow. ‑ 732 p.
6. Durandina E.E. (1985). Vokalnoye tvorchestvo Musorgskogo. [Vocal works of Mussorgsky].  Moscow. – 200 p.
7. Zenkin, K.V. (1997) Fortepiannaya miniatyura i puti muzykalnogo romantizma. [Piano miniatures and ways of romanticism in music.]. Moscow. 1997. – 509 с.
8. Cui, C.A. (1985) Izbrannye stayi. [Selected articles]. ‑ Leningrad. ‑ 691 p.
9. Molas, A.N. (1989) Vospominaniya o Mussorgskom.  [Reminiscences of Mussorgsky].  Mussorgsky v vospominaniyakh sovremennikov [Mussorgsky in his contemporaries` reminiscences]. Moscow. ‑ P. 98-100.
10. Mussorgsky,M.P. (1932). Pisma I dokumenty [Letters and documents]/ Rimsky-Korsakov, A.N. (ed.). Moscow & Leningrad.  577 p.
11. Mussorgsky V. (1989). V vospominaniyakh sovremennikov [Mussorgsky in his contemporaries` reminiscences]. Moscow. – 319 p.
12. Nemirovskaya, I.A. (2011). Fenomen detstva v russkoy muzyke. [The phenomenon of childhood in Russian music.] Moscow.  392 p.
13. Rouchyevskaya, E.A. (1993). Slovo i vneslovesnoye soderzhanye v tvorchestve Mussorgskogo. [Contents of Mussorgsky`s works: words and beyond.].  Musykalnaya Akademia. #1. ‑ P. 200-203.
14. Skvortsova, I.A. (2009). Stil modern v russkom muzykalnom iskusstve roubezha XIX−ХХ vekov. [Modernist style in Russian music at the turn of the XIX and ХХ centuries.]. Moscow. 354 p.
15. Stassov, V.V. (1977). Statyi o muzyke. [Articles on music.] Issue 3. Moscow. ‑ 335 p.
16. Kholopov, Y.N. (2002). Mussorgsky kak master musykalnoy formy (“Kartinki s vystavki”) [Mussorgsky as a music form master (“Pictures at an exhibition”)].  Musykalnaya kultura XIX - ХХ [Music culture XIX - ХХ]/ Nemirovskaya I.A. (ed.). Issue 2. Moscow. P. 25-54.
17. Shcherbakova, A.I. (2014). Philosophical understanding of music as a methodological basis of research in the field of musical art and education. Life Science Journal, 11(11), 429-432. http://www.lifesciencesite.com
18. Engel, Y.D. (1971). Glasami sovremennika. [From the viewpoint of a contemporary.].  Isbrannye statyi o russkoy musyke (1898-1918). [Selected articles on Russian music (1898-1918).]. Moscow. P. 202-224.
19. Jung, C. (1995). Konflikty detskoy dushi. [Conflicts of a child soul.]. Moscow. 274 p.
20. Forrai, K. (1997). Music as poetry for the youngest ones.  Bulletin of the international Kodaly society. Vol. 22, # 1. − P. 22−25.
21. Nemirovskaya, I. A. (2016). The World of Childhood in Mussorgsky’s Opera «Boris Godunov».  “American Science Review”, # 1. http://american-science.com/en/category/2016/
22. Hair, H. (1993/1994). Children’s descriptions and representations of music. Bulletin of the Council for Research in Music Education, 119, 41 − 48

1. McVaugh, Michael. The importance of multilingualism. University of North Carolina. http://multilingualism.org/multilingualism/the-importance-of-multilingualism.
2. Education in the multilingual world: Adjusting document of UNESCO. Paris,2003.-38с. http://www.unesco.org/new/ru/media-services/single-iew/news/multilingualism_a_key_to_inclusive_education/#.VNbyXufqCJU.
3. Teaching and Learning: Towards the Learning Society. (1995). European Commission's White Paper, 1995 Brussels: The European Union.
4. Key Data on Teaching Languages at School in Europe. (2012). Education, Audiovisual and Culture Executive Agency. http://ec.europa.eu/eurostat/en/web/products-statistical-books/-/EC-XA-12-001.
5. Constitution of the Republic of Kazakhstan of August 30, 1995. http://adilet.zan.kz/rus/search/docs/va=КОНС.
6. The Republic of Kazakhstan Law “About languages” of July 11, 1997. http://adilet.zan.kz/rus/docs/Z970000151.
7. The Law “About education” of July 27, 2007 No. 319-III.Kazakhstan Pravda.2007. No. 127. August 15.
8. State program of languages functioning in the Republic of Kazakhstan for 2001-2010. Kazakhstan Pravda.  2001. No. 47-48. February 17.
9. State program of education development in the Republic of Kazakhstan for 2011-2020. Decree of the President of the Republic of Kazakhstan of 07.12. 2010 No. 1118. - http://adilet .zan.kz/rus/docs/U1000001118.
10.  Concept of the development of foreign-language education of the Republic of Kazakhstan. Almaty: КazUMOiMY an. a. Abylay khan, 2006. http://freeref.ru/wievjob.php? id=8721752006.
11.  Abdildin,  Zh. M., et al. (1990).  Logic - gnosiological analysis of science. - Alma-Ata: Gylym,  491 p.
12.  Kusherbayev, K. E. (1996). Ethno-cultural aspects of educational policy of sovereign Kazakhstan//Evolution of Statehood of Kazakhstan. Almaty.  P. 109-112.
13.  Nysanbayev, A., Suleymenov F.  (1993). Sociocultural choice of model of education, Thought, 12,  58-62.
14.  Chasanoff, B. (1989). National languages, bilingualism and multilingualism. Searches and prospects. Alma-Ata, 133 p.
15.  Yerzhanov, M. E. (1999). Development of ethno-cultural education in Kazakhstan: Theoretical bases and practice.–Diss. for academic degree of Doc. Sci, code of spec. 13.00.05, Moscow.  429 p.
16.  Large Soviet Encyclopedia: Linguistics. (1998). M., 303 p.
17.  Zhetpisbayeva, B.A. (2009).  Theoretical-and-methodological bases of polylingual education. Diss. of Doc. Ed./Karaganda, 46 p.
18.  Vez, José Manuel. (2009): Multilingual Education in Europe: Policy Developments. Portaernández Linguarum, M.ª P. N 12, junio 2009 ÚÑEZ Y A. ROM (http://www.ugr.es/~portalin/articulos/PL_numero12/1JM%20Vez.pdf)
19.  Cenoz, Jasone (2009): Towards Multilingual Education. Bristol: Multilingual Matters.
20.  Coste, Daniel & Simon, Diana-Lee (2009): The plurilingual social actor. Language, citizenship and education. International Journal of Multilingualism, Vol. 6, Number 2: 168-185.
21.  Coyle, Do (2007): Content and Language Integrated Learning: Towards a Connected Research Agenda for CLIL Pedagogies. The International Journal of Bilingual Education and Bilingualism. Vol. 10, No. 5: 543-562. http://dx.doi.org/10.2167/beb459.0
22.  Goverdovskaya Ye. V. (2009). Development of higher education in the polycultural region (on materials of the North Caucasus). Diss. of Doc. Ed. 13.00.08 - Theory and a technique of professional education (pedagogical sciences). St. Petersburg, 40 p.
23.  Baker, Colin (2011): Foundations of Bilingual Education and Bilingualism. 5th edition. Bristol: Multilingual Matters.
24.  Byram, Michael S. (2012). Language awareness and (critical) cultural awareness - relationships, comparisons and contrasts. Language Awareness 21 (1-2): 5-13.
25.  Casanave, Christine Pearson (2003): Controversies in Second Language Writing: Dilemmas and Decisions in Research and Instruction (Michigan Series on Teaching Multilingual Writers). Ann Arbor: University of Michigan Press.
26.  Bartlett, Lesley / Kleifgen, JoAnne / García, Ofelia/ (2007): From Biliteracy to Pluriliteracies. Handbook of Applied Linguistics. Vol. 5: Multilingualism, ed. by Peter Auer and Li Wei. Berlin: Mouton/de Gruyter, 207-228.
27.  Lantolf, James P. & Thorne, Steven L. (2006): Sociocultural Theory and the Genesis of Second Language Development. Oxford: Oxford University Press.
28.  Canagarajah, Suresh (2011): Codemeshing in Academic Writing: Identifying Teachable Strategies of   Trans languaging. The Modern Language Journal, 95, iii: 401–417.
29.  Coetzee - Lachmann, Debbie (2009): Assessment of subject-specific task performance of bilingual geography learners: Analysing aspects of subject-specific written discourse. Osnabrück: Universität (http://elib.ub.uni-osnabrueck.de/publications/diss/E-Diss864_thesis.pdf).
30.  Gajo, Laurent (2007): Linguistic Knowledge and Subject Knowledge: How Does Bilingualism Contribute to Subject Development? International Journal of Bilingual Education and Bilingualism, 10(5), 563-581.
31.  García, Ofelia/ Kleifgen, JoAnne/ Falchi, Lori (2007): Education, Multilingualism and Trans languaging in the 21st century. In Equity in the Education of Emergent Bilinguals: The case of English Language Learners. Teachers College, Columbia University: Campaign for Educational Equity, 140-158.

1. Babanskaya, O.M., Mozhaeva, G.V., Serbin, V.A., Feschenko, A.V. (2015). Sistemnyy podkhod k organizatsii elektronnogo obucheniya v klassicheskom universitete [Systematic approach to e-learning in the classical university]. Otkrytoe obrazovanie. Nauchno-prakticheskiy zhurnal, 2, pp. 63-69.
2. Bogomolov, A.N. (2011). Virtualnaya sreda obucheniya RKI: opyt organizatsii uchebnogo protsessa v novoy obrazovatelnoy modeli [Virtual learning environment RCT: the experience of the educational process in a new educational model]. XII Kongress MAPRYAL “Russkiy yazyk i literatura vo vremeni i prostranstve”, V. 3, Shankhay, pp. 324-329.
3. Dneprovskaya, N., Koretskaya, I., Dik, V., Tiukmenova, K. Study of social media implementation for transfer of knowledge within educational milieu. Scientific bulletin of national Mining University, 4, Ukraine: Dnipropetrovsk.
4. Gartsov, A.D., Gartsova, D.A. (2015). Teoreticheskie i tekhnologicheskie strategii postroeniya professionalno orientirovannoy setevoy obrazovatelnoy sredy [Theoretical and technological strategy of building a network of professionally-oriented educational environment]. Vestnik RUDN. Ser. “Russkiy i inostrannyy yazyki i metodika ikh prepodavaniya”, 3, pp. 24-27.
5. Dendev, B., (ed.) (2013). Informatsionnye i communikatsionnye technologii v obrazovanii: monografiya [Information and communication technologies in education: a monograph]. Moscow: IITO UNESCO, 320 p.
6. Kontseptsiya informatizatsii vysshego obrazovaniya Rossiyskoy Federatsii [Informatization Concept of the Russian Federation Higher Education] (1993). Retrieved from: http //www.pandia.ru/text/77/305/24712.php.
7. Kulikova, S.S., Yakovleva, O.V. (2010). Individualnaya informatsionnaya obrazovatelnaya sreda kak uslovie professionalnogo razvitiya studenta. Pedagogicheskoe obrazovanie v perekhodnyy period: rezultaty issledovaniy 2010 goda. [Individual information educational environment as a condition for professional development of the student. Teacher education in transition: the results of research in 2010]. SPb.: Lemma, pp. 323-329.
8. Nazarenko, A.L. (2015). Informatizatsiya obrazovaniya: sintez traditsionnogo i elektronnogo obucheniya (opyt sozdaniya novoy modeli lektsionnogo kursa) [Informatization of Education: a synthesis of traditional and e-learning (experience of creating a new model of the lecture course)]. Otkrytoe obrazovanie. Nauchno-prakticheskiy zhurnal, 2(109), 71-72.
9. Noskova, T.N. (2007). Kakuyu informatsionno-obrazovatelnuyu sredu mozhno schitat vysokotekhnologichnoy? [What kind of information-educational environment can be considered a high-tech?] Universum: Vestnik Gertsenovskogo universiteta, 1, pp. 45-47.
10. Pavlova T.B.(2012). Novye obrazovatelnye strategii v sovremennom informatsionnom prostranstve [The new educational strategies in the modern information space]. SPb.: Izd-vo Lema, 208 p.
11. Pavlova, T.B. (2012). Informatsionnyy resurs kollektivnogo pedagogicheskogo soprovozhdeniya vneauditornoy samostoyatelnoy raboty studentov [Information resource of collective pedagogical support of students' independent work]. In Novye obrazovatelnye strategii v sovremennom informatsionnom prostranstve. SPb.: Izd-vo Lema, pp. 148-153.
12. Sami Ben Romdan. (2013). Perspektivy ispolzovaniya sotsialnykh setey v obuchenii RKI [Prospects for the use of social networks in the learning trials]. Russkiy yazyk za rubezhom, 4, pp. 101-105.
13. Semenova, I.N., Slepukhin, A.V. (2014). Didaktichekiy konstruktor dlya proektirovaniya modeley elektronnogo, distantsionnogo i smeshannogo obucheniya v vuze [Didactic constructure for the model design of electronic, distant and blended learning in high school]. Innovatsiya v praktike obrazovaniya, 8, pp. 68-69.
14. Skorikova, T.P. (2013). Obuchenie teorii i praktike mezhkulturnoy kommunikatsii (s ispolzovaniem virtualnoy obrazovatelnoy sredy) [Education Theory and Practice of Intercultural Communication (using a virtual learning environment)]. Vestnik RUDN. Ser. “Russkiy i inostrannyy yazyki i metodika ikh prepodavaniya”, 2, pp. 136-143.
15. Skorikova, T.P., Orlov, E.A. (2013). Aktivizatsiya poznavatelnoy deyatelnosti magistrantov v uchebno-nauchnoy sfere pri ispolzovanii informatsionno-kompyuternykh tekhnologiy [Activation of cognitive activity in graduate teaching and research field of the use of information and computer technologies]. Izvestiya Yugo-Zapadnogo gosudarstvennogo universiteta. Ser. “Lingvistika i pedagogika”, 1, pp. 87-92.
16. UNESCO (2001) Struktura IKT kompetentnosti uchiteley. Rekomendatsii UNESCO [The structure of the ICT competence of teachers. UNESCO Recommendation]. Retrieved from: htpp://ru.iite.unesco.org//publications/3214694/.
17. Tikhomirov, V. Dneprovskaya, N. Yankovskaya, E. (2015). Three Dimensions of Smart Education. Smart Education and Smart e-Learning, Smart Innovation, Systems and Technologies, 41, pp. 47-57.  DOI 10.1007/978-3-319-19875-0_5
18. Tikhomirov, V.P., Tikhomirova, N.V. (2012). Rossiya na puti k Smart obschestvu [Russia on the path to smart society: monograph]. Moscow: NP “Tsentr razvitiya sovremennykh obrazovatelnykh tekhnologiy”, 280 p.
19. Urintsov, A., Dik, V., Dneprovskaya, N. (2014). Individual Learning Trajectories as a Key Educational Tool in the Information Society. SMART DIGITAL FUTURES. Netherlands: Amsterdam, pp.652-657
20. Zhdanova, E.V., Kharitonova, O.V., Khromov, S.S. (2012). K voprosu o kriteriyakh otbora i otsenki veb-resursov v prepodavanii inostrannykh yazykov i russkogo yazyka kak inostrannogo [On the issue of the selection criteria and evaluation of web resources in the teaching of foreign languages and Russian as a foreign language]. Vestnik UMO “Ekonomika, statistika i informatika”, 3, pp. 8-16.

1. Abdygaparova, S.B., Akhmetova, G.K., Ibatulin, S.R., Kusainov, A.A., Myrzaliev, B.A., Omirbaev, S.M. (2004). Osnovykreditnoysistemyobucheniya v Kazakhstane. (Eds. Zh.A. Kulekeev, G.N. Gamarnik, B.S. Abdrasilov). Almaty: Kazakh universitety, 198 p.
2. Artamonova, M.V. (2008). ReformavyssheyshkolyiBolonskiyprotsess v Rossii (chastnyyvzglyadmetodista). M.: Ekonomika, p. 378.
3. Bateshov, E.A. (2006). Pedagogicheskieosnovykompyuternogokontrolno-obuchayuschegotestirovaniyakachestvaznaniystudentovnaprimerefiziki: Avtoref. dis. kand. ped. nauk. Astana, 25 p.
4. Baydenko, V.I., O.L. Vorozheykina, Karachrova, E.N., Selezneva, N.A., Tarasyuk, L.N. (2009). Bolonskiyprotsess: Glossariy (naosnoveopytamonitoringovogoissledovaniya). (Ed. V.I. Baydenko and N.A. Selezneva). M.: Issledovatelskiytsentr problem kachestvapodgotovkispetsialistov, 148 p.
5. Bolonskiyprotess: evropeyskieinatsionalnyestrukturykvalifikatsii: kniga-prilozhenie 2. (2010). (Ed. V.I. Baydenko). M-voobrazovaniyainauki RK, Departamentvyssh. poslevuz. obrazovaniya. Nauch. izd. Astana: [NKAOKO], 218 p.
6. Dzusubalieva, D.M. (1997). Teoreticheskieosnovyformirovaniyainformatsionnoykulturystudentov v usloviyakhdistantsionnogoobucheniya. Alamty, 221 p.
7. Erakhtina, I.I. (2009). Podgotovkastudentov v oblastistandartizatsii, metrologii I sertifikatsiinaosnoveinteraktivnykhmetodovobucheniya: Avtoref. dis. …kand. ped. nauk. Astana, 27 p.
8. GosudarstvennayaprogrammarazvitiyaobrazovaniyaRespubliki Kazakhstan na 2011-2020 gosy, ot 7 dekabrya 2010 goda #1118. Informatsionno-pravovaya Sistema normativnykhpravovykhaktovRespubliki Kazakhstan. Retrieved from: /adilet.zan.kz.
9. Kolesnikov, Yu.Yu. (2012). Obespecheniekachestvaobucheniyacherezinformatsionno-obrazovatelnuyusreduvuza. VestnikKazNUim. Al-Farabi. Ser. pedagogicheskienauki, 1, 9-12.
10. Kusainov, A.A. (2009). Bolonskiyprotsessireformirovanievysshegoobrazovaniya v Kazakhstane: informatsionnyematerialydlyaprakticheskikhdeystviy. Almaty, 120 p.
11. Lobanova, E. (2005). Novaya informatsionno-obrazovatelnayasredavuza. Alma-mater, Vestnikvyssheyshkoly, 5, 49-51.
12. Mukhametkaliev, T.M. (2011). Bolonskiyprotsess v Kazakhstane: obyektivnyyvzglyad. Sovremennoeobrazovanie, 1, 20-24.
13. Nurgalieva, G.K. (2010). Metodologiyaitekhnologiyaelektronnogoobucheniya. Monografiya. Almaty, 198 p.
14. Orazalina, Z.Z. (2011). Professionalnayadeyatelnostprepodavateleyuniversiteta v usloviyakhprimeneniyasetevykhelekronnykhuchebnykhresursov. Mezhdunarodnyynauchnyyzhurnal “Mir nauki, kultury, obrazovaniya”, 6(3), pp. 31-35, Gorno-Altaysk.
15. Plekhanov, S.P., Lepe, L.I. (2005). Bolonskiyprotsessisistemasoprovozhdayuschegoobucheniyainformatsionnymtekhnologiyam. SborniktrudovKongressakoferentsiy ITO. M.: Bit pro., p. 49.
16. Shalaev, I.K., Veryaev, A.L. (2010).Otobrazovatelnykhsred k obrazovatelnomuprostranstvu: ponyatie, formirovanie, svoystva. Retrieved from: http://www.uni-altai.ru/Journal/pedagog/pedagog_4/articl_1.html.
17. Shevelev, N.A. (2010). Informatsionnyeresursyuniversiteta. Vyssheeobrazovanie v Rossii, 5, 91-95.
18. Tazhigulova, G.A., Sarzhanova, G.B. (2010). Organizatsiyasamostoyatenoyrabotystudentov v usloviyakhkreditnoytekhnologiiobucheniya. V mire obrazovaniya, 3, 9-12.
19. Traynev, V.A., Mkrtchyan, S.S., Savelyev, A.Ya. (2008). PovysheniekachestvavysshegoobrazovaniyaiBolonskiyprotsess: obobschenieotechestvennoyizarubezhnoypraktiki. M.: Izdatelsko-torgovayakorporatsiya “Dashkovi K”, 392 p.
20. Zavalko, N.A. (2012). Individualizatsiyaobrazovatelnogoprotsessa. Ust-Kamenogorsk, 251 p.

Anderson, R. (2010). The “Idea of a University” today. History & Policy. Retrieved from http://www.historyandpolicy.org/policy-papers/papers/the-idea-of-a-university-today

Bakulina, T. (2001). Kak izbavit’sia ot nefti? Astrakhanskaya studentka izobrela unikal’ny preparat. Moskovskiye Novosti, 43(1111), 33-35.

Baratashvili, G. (2009). Your Career. Cosmopolitan, 8, 186.

Bourgeois, E. (2002). Developing foresight for the development of higher education/research relations in the perspective of the European Research Area. Retrieved from http://bookshop.europa.eu/ga/developing-foresight-for-the-development-of-higher-education-research-relations-in-the-perspective-of-the-european-research-area-era--pbKINA20511/

Bruner, J. S. (2006). Science education and teachers: a Karplus Lecture (2), 12. London: Routledge. 17-22.

Carr, D. (2003). Making Sense of Education. London: Routledge, 319 p.

Cuypers, S. E. (2004). Critical Thinking, Autonomy and Practical Reason. Journal of Philosophy of Education, 38(1), 75–90.

Efimenko, A. (2000). My challenge to children’s mortality. In 12th European Union Contest for Young Scientists. Bergen: The Netherlands Yong Scientists Foundation, 83-87.

Godon, R. (2004). Understanding, Personal Identuty and Education. Journal of Philosophy of Education, 4, 589–600.

Greenaway, D., & Haynes, M. (2003). Funding Higher Education in the UK. The Economic Journal, 113(485), 150–166.

Gregorieva, V. (2000). Нow to make a profit from waste material. 12th European Union Contest for Young Scientists. Bergen, 84 p.

Gureev, A. (2001). Home Laser Appliance to Diagnose Cancer. 13th European Union Contest for Young Scientists. Brussels-Oslo, 29 p.

Haddad, G. (2009). Communique. 2009 World Conference on Higher Education: The New Dynamics of Higher Education and Research For Societal Change and Development. Paris, Effs, 53 p.

Hammershoj, L. G. (2009). Creativity as a Question of Bildung. Journal of Philosophy of Education, 43(4), 545–558.

Ilchenko, A. (2011). It’s not interesting, is it? Poisk, 13(1139), 2 p.

Karpov, A. (2015). Formation of the Modern Concept of Research Education: From New Age to a Knowledge Society. Procedia - Social and Behavioral Sciences, 214, 439–447. http://doi.org/10.1016/j.sbspro.2015.11.718

Karpov, A. O. (2013). Sociocognitive structure and education in the knowledge society. Obschestvo I Ekonomika, 11, 5–20.

Mackenzie, J. (1998). Science Education after Рostmodernism. London and New York: Routledge, 326 p.

Obuschenko, A. (2002). Light-induced Particle Aggregation. In E. C. Directorate-General (Eds.), 14th European Union Contest for Young Scientists. Vienna, 263 p.

Pokholkov, Y. P. (2011). Sad but true. The proposition about the world’s best Russian education sounds unconvincing today. Poisk, 10(1136-1137), 13-17.

Shadrikov, V. D. (2002). Introduction in psychology: Man’s abilities. Moscow: Logos. 252 p.

Simons, M. (2006). “Education Through Research” at European Universities: Notes on the Orientation of Academic Research. Journal of Philosophy of Education, 40(1), 31–50.

Tomlinson, J. (2000). Policy and Governance. Tomorrow’s Schools – Towards Integrity. London and New York: Routledge Falmer, 180 p.

Winch, C. (2004). Developing Critical Rationality as a Pedagogical Aim. Journal of Philosophy of Education, 38(3), 467–484.

Piaget J. (1952). The origins of intelligence in children. New York: International Universities Press, 8(5), 53-67.

Agafonova, N.N., Brehach, R.A. & Zhadayev, D.N. (2009). The content of the public procurement for the educational system: effective mechanisms to create a professional environment and mechanisms to show results of implementation of the public procurement by the professional community. Perm: Perm State Pedagogical University, 264 p.

Bayborodova, L.V., Belkina, V.V. & Kharisova, I.G. (2014). Psychological and pedagogic support for children in supplementary education system. Yaroslav: K.D. Ushinsky Yaroslavl State Pedagogical University Publishing house, 107 p.

Bourdieu, P. (2005). Social Space Sociology. (In N.A. Shmatko, Trans., Eds.). Saint Petersburg: Aleteya; Мoscow: Experimental Sociology Institute, 91-110.

Bray, T. M., & Kwo, O. W. Y. (2014). Regulating private tutoring for public good: Policy options for supplementary education in Asia. UNESCO and Comparative Education Research Centre, HKU, 264 p.

Clarijs, R. (2008a). Unlimited Talents and Non-Formal Education. A Contribution to the Discussion about the Future Role and Position of After-School Education in Europe, 11, 25-41.

Clarijs, R. (2013). Tirannie in de jeugdzorg. Een onderzoek naar de mogelijkheden van beleidsveranderingen. Amsterdam: SWP.

Clarijs, R.  (2008b). Leisure and Non-Formal Education. A European overview of After- and Out-of-School Education. Prague: Zenka, 21.

Clarijs, R., Guidikova, I. & Malmberg, Th. (eds.) (2011). Diversity and community development. An intercultural approach. Amsterdam: SWP, 255.

Flynn, J. R. (2012). Are We Getting Smarter? Rising IQ in the Twenty-First Century. Cambridge: Cambridge University Press, 324 p.

Golovanov, V.P. (2013). Supplementary education for children and teenagers. Krasnoyarsk: Siberian Pedagogic University, 122 p.

Kaloshina, T.Yu. (2006). A social demand as a condition of the educational services management: In the case of training specialists in economics in universities of Chita (Doctoral Dissertation). Chita:Chita State University, 438 p.

Kosaretsky, S., Kupriyanov, B., & Darya, F. (2016). Specific Features of Children Involvement in Supplementary Education Depending on Cultural, Educational and Financial Status of Families and Place of Living. Educational Studies, (1), 168-190.

Kupriyanov, B.V. (2011). Social Education in Supplementary Educational Institutions for Children. (Doctoral Dissertation), Коstromа: Kostroma Nekrasov State University. 417 p.

Lekomtseva, E.N. & Sukhanova, Yu.V. (2012). Experience of studying the social demand for supplementary education for children. Yaroslavl Pedagogical Journal (Series “Psychological and Pedagogical Sciences”), 2(2), 244-248.

Litvak, R.A. & Kazymov, V.B. (2012). Innovation Science in the Management of Supplementary Education System. Modern Issues of Science and Education, 6. Retrieved from: http://www.science-education.ru/pdf/2012/6/268.pdf

Mills, C. J., Ablard, K. E. & Gustin, W. C. (1994). Academically talented students' achievement in a flexibly paced mathematics program. Journal for Research in Mathematics Education, 25, 495-511.

Mori, I. (2013). Supplementary education in the United States: Policy context, characteristics, and challenges. Out of the shadows: The global intensification of supplementary education, 22, 191-207.

Mukhamedyarova, N.A. (2012). The public procurement for the educational system for children. Yaroslavl Pedagogical Journal, 2(2), 234-239.

Nechiporuk, E.P. & Zolotareva, A.V. (2014). Analisi su richiesta della formazione mercato del lavoro servizi personale supplementare dei bambini in Russia. Italian Science Review, 7(16), 183-186.

Potashnik, M.M. (2006). Education quality management: monograph and textbook. Series “Education of the 21st century”. Moscow: Pedagogical society of Russia.

Reznik, I.B. (2005). The public procurement in the Soviet musical art of the 1930s (Doctoral dissertation). Yekaterinburg: Urals Mussorgsky State Conservatoire, 425 p.

Ryabova, V.I. (2010). Formation of Children’s Readiness for International Communication as One of the Topical Directions of Development of Out-of-School (Supplementary) Education of Children in Kazakhstan. In A. Zolotareva (Ed.), Topical tendencies in the development of out-of-school (non-formal) education in Eastern European countries: Survey of Belarus, Kazakhstan, Russia, Ukraine: Teaching aid. (pp. 21). Prague-Yaroslavl: EAICY-YSTTU.

Shkliar, H.L., Yakauleva, I.A. & Sinichkina, L.P. (2010). Out-of-School Education and Training in Belarus as a Sphere of Social Creative Work. In A. Zolotareva (Ed.), Topical tendencies in the development of out-of-school (non-formal) education in Eastern European countries: Survey of Belarus, Kazakhstan, Russia, Ukraine: Teaching aid. (pp. 222). Prague-Yaroslavl: EAICY-YSTTU.

Sukhanova, Y.V. (2012). Social Demand for Supplementary Education of Children. Yaroslavl: YASPU, 7(2), 54-62.

Zolotareva, A. (2013a). Children’s Supplementary Education in Russia in the 21st Century: Teaching Aid. Ushinsky Yaroslavl State Pedagogical University, 9(99), 81-83

Zolotareva, A.V. & Sukhanova, Y.V. (2013). The study results of social demand for supplementary education for children. Yaroslavl Pedagogical Journal, 2(2), 131-136.

Zolotareva, A.V. (2013b). Supplementary education for children in Russia in the 21st century: Manual. Prague-Yaroslavl: EAICY-YSPU, 215 p.

Zolotareva, A.V. (2013c). The concept and essence of the social demand for supplementary education for children in Russia. In W. Strielkowski & I Čábelková (Eds.), Marketing, management and production in educational and publication activites in former USSR countries and Eastern Europe (pp.35-45). Prague: Charles University in Prague, Faculty of social sciences.

Zolotareva, A.V. (2014). How satisfied are parents quality supplementary education for children in Russia? In Y. Maximov (Ed.), Applied and Fundamental Studies: Proceedings of the 6rd International Academic Conference (pp.105-110). St. Louis, Missouri: Publishing House Science and Innovation Center.

Athique, A. (2016). Post-industrial Development and the New Leisure Economy. InGlobalisation and the Challenges of Development in Contemporary India61-76). New York: Springer Singapore.

Bijwaard, G. E., Schluter, C., & Wahba, J. (2014). The impact of labor market dynamics on the return migration of immigrants.Review of Economics and Statistics,96(3), 483-494.

Bleikh, H. Y., & Young, W. L. (2016).. CRC Press, 11, 17-19.

BLS Handbook of Methods, Division of BLS Publishing. 1997. Washington: DC, 62 p.

Davidson, С. & Nicholas, S. (2013): A Simple Model of Clobalization, Schooling and Skill Acquisition. Direct access: http://hdl.handle.net/10419/84176.

Didkovskaya, Y. (2014). Dynamics of professional career strategies in the transformation of professional self-determination model. Sociology, 2, 14-23.

Giovannelli, A., & Proietti, T. (2016). On the Selection of Common Factors for Macroeconomic Forecasting.Dynamic Factor Models (Advances in Econometrics, Emerald Group Publishing Limited,35, 593-628.

Groen, J. J., & Kapetanios, G. (2016). Revisiting useful approaches to data-rich macroeconomic forecasting. Computational Statistics & Data Analysis, 100, 221-239.

Gurtov, V. A., Garifullina, N. Y., & Sigova, S. V. (2016). Forecasting recruitment needs of the Russian economy: Qualitative aspects. Studies on Russian Economic Development, 27(1), 68-75.

Kosorukov, O.A. (2015). Forecasting the economic demand for vocational training. Moscow: MGU. 78-8534

Lindley, J., & Machin, S. (2014). Spatial changes in labour market inequality.Journal of Urban Economics,79, 121-138.

Makarov, A. N., Nazmeev, E. F., Maksutina, E. V., & Alpatova, E. S. (2014). Education reform in context of innovative development of the Russian economy.Life Science Journal,11(6s), 372-375.

Mukhametshina, G. R., Bulatov, A. N., & Antonova, N. V. (2014). Methods to Provide Supply and Demand Balance on the Regional Industrial Labour Market. Mediterranean Journal of Social Sciences, 5(12), 145.

Nyen Wong, K., & Cheong Tang, T. (2011). Foreign direct investment and employment in manufacturing and services sectors: Fresh empirical evidence from Singapore.Journal of Economic Studies, 38(3), 313-330.

Parks, B., Olson, P. D., & Bokor, D. W. (2015). Don't mistake business plans for planning (it may be dangerous to your financial health).Journal of Small Business Strategy, 2(1), 15-24.

Pitukhin, E.A., Gurtov, V.A. (2006). "Mathematical modeling of dynamic processes in the system" economy - the labor market - vocational education ".Moscow: AST, 242 p.

Rasdorf, W., Hummer, J. E., & Vereen, S. C. (2016). Data Collection Opportunities and Challenges for Skilled Construction Labor Demand Forecast Modeling.Public Works Management & Policy, 21(1), 28-52.

Scanlon, W. J., & Holt, C. C. (2014, May). Demand for Labor in a Dynamic Theory of the Firm. InAdaptive Economic Models: Proceedings of a Symposium Conducted by the Mathematics Research Center, the University of Wisconsin–Madison. Academic Press, 34, 327.

Skousen, M. (2016).The making of modern economics: the lives and ideas of the great thinkers. London: Routledge, 33 p.

Teslenko. I.V. (2014). Development of human resources in accordance with labor market needs by the example of Sverdlovsk Region. Basic research, 12, 16-19.

Upward, R. & Wakelin, K. (2002). Trade, investment, migration and labour market adjustment. New York: Palgrave Macmillan, 243 p.

Zenou, Y. (2015). A dynamic model of weak and strong ties in the labor market.Journal of Labor Economics,33(4), 891-932.

Zhu, X. (2014). The Effect of Education on Economic Growth–An Empirical Research Based on the EBA Model Journal of Interdisciplinary Mathematics, 17(1), 67-79.

Borisenko, I. & Volodina, D. (2015). Educational Smart Technologies in the Educational Process. Journal of Siberian Federal University: Humanities and Social Sciences, 8(3), 489-493.

Buldygina, L. (2007). Implementation of monitoring as a means of managing the professional development of pedagogues. Informatics and Education, 4, 103-108.

Cawelti, G. (2000). Handbook of Research on Improving Student Achievement. Alexandria: Educational Research Service, 263 p.

Coates, H. (2010). Defining and monitoring academic standards in Australian higher education. Higher Education Management and Policy, 22(1), 1-17.

Gorb, V. (2003). Technological aspects of pedagogical monitoring of interrelations of the subjects of educational activity at university. Standards and monitoring in education, 2, 46-52.

Isaev, A., Isaeva, L. & Kravets, A. (2013). Individualized Educational Trajectory: Educational Courses Integration. World Applied Sciences Journal, 24, 62-67.

Kara, A. & Skornichenko, N. (2012). Monitoring Of The Basic Educational Programs Mastering Quality In The System Of The University Innovative Activity. European Journal of Business and Economics, 7, 45-52.

Kovalenko, I. (2012). Pedagogical monitoring as a means of managing the quality of education. Newsletter of Tula State University. The Humanities, 1(2), 262-271.

Kozhanova, M. (2016). Features of Pedagogical Management of Students Civil and Patriotic Qualities Forming. International Review of Management and Marketing, 6(2S), 20-31.

Lenske, G. (2016). The importance of pedagogical knowledge for classroom management and for students' achievement. Zeitschrift Fur Erziehungswissenschaft, 19(1), 211-233.

Levina, E. (2016). Efficiency Management of Educational Systems Development: Approaches and Criteria. International Review of Management and Marketing, 6(2), 12-23.

Lovett, T., Clarke, C. & Kilmurray, A. (1983) Adult education and community action. Hampshire: Croom Helm, 363 p.

Mayorov, A. (2005). Monitoring in education. Moscow: Intellect Centre, 264 p.

Nikolaenko, V., Grakhova, E. & Rakhimov, T. (2016). Improving the Efficiency of the Educational Process Using Interactive Teaching Methods. Retrieved from:  http://festival.1september-.ru/articles/521876/

Scheerens, J. (2003). Educational evaluation, assessment, and monitoring. Abingdon: Taylor & Francis, 325 p.

Shatalov, A. (2008). Monitoring and diagnostics of the quality of education. Moscow: Social Projects Institute, 175 p.

Shilibekova, A. S. (2011). Pedagogical monitoring in the system of general secondary education. The Gazette of Kazakh National Pedagogical University named after Abai, Pedagogical sciences series, 4 (32), 91-95.

Spector, J. M. & Yuen, A. H. (2016). Educational Technology Program and Project Evaluation. London: Routledge, 264 p.

Tazhbayeva, S., Assilkhanova, M. & Ilimkhanova, L. (2014). Conceptualizing for Educational Work Organization in Institutions of Higher Education: Mission, Goals, and Pedagogical Strategies for Reforming Higher Education in Kazakhstan. Mediterranean Journal of Social Sciences, 5(20), 27-38.

Turgunbayeva, B. & Tikhomirova, V. (2006). Pedagogical monitoring in the system of intensive further training of teachers. Almaty: Kazakh Universiteti, 114 p.

Van Den Bogaart, A. C. (2016). A computer-supported method to reveal and assess Personal Professional Theories in vocational education. Technology, Pedagogy and Education, 1, 1-17.

Vlasova, V. K. & Kirilova, G. I. (2012). Algorithms of monitoring and control of educational process in the context of electronic educational resources. Quality Innovations Education, 7, 36-40.

Willms, J. D. (2003). Monitoring school performance. London: Routledge, 163 p.

Yelistratova, I. V. (2015). Pedagogical monitoring in the system of assessing the quality of educational process at a teacher’s level. Direct access: http://festival.1september.-ru/articles/521876/

Yepaneshnikov, V. V. (2016). Pedagogical management of civil education of research universities students. International Review of Management and Marketing, 6(2), 12-18.

Zeer, E. F. (2005). Psychology of profession. New-York: Foundation World, 352 p.

Alake-Tuenter, E. (2012). Inquiry-Based Science Education Competencies of Primary School Teachers: A literature study and critical review of the American National Science Education Standards. International Journal of Science Education, 17(34), 2609-2640.

Alekseeva, L. (2009). Expected results of the primary general education. Moscow: Prosveshchenie, 253 p.

Antonenko E. (2010). Formation of intellectual and cognitive competence as a factor for developing culture of independent educational activity in schoolchildren (Doctoral Dissertation). Vladikavkaz: North-Ossetian State University, 427 p.

Asmolov, A., Burmenskaya, G. & Volodarskaya, I. (2008). How to design universal educational activities at an elementary school, from action to thought. Moscow: Prosveshchenie, 263 p.

Asmolov, A., Burmenskaya, G. & Volodarskaya, I. (2011). Formation of universal educational actions at the basic school: from action to thought. Moscow: Prosveshchenie, 366 p.

Babansky, Yu. (1989). Rational organization of educational activity. Moscow: Pedagogika. 322 p.

Herborn, K., Mustafic, M. & Greiff, S. (2015). Validating the PISA 2015 collaborative problem solving approach, Luxembourg: Licet, 278 p.

Khutorskoy, A. (2003). Key competences as a component of personally oriented paradigm of education. Pop. Education, 2, 58–65.

Kirsch, C. (2012). Developing children's language learner strategies at primary school. Education, 3, 379-399.

Kozlova, V. & Kondakova, A. (2011). The fundamental core of the content of general education. Moscow: Prosveshchenie, 345 p.

Krasnozhonova, E. (2013). Development of Schoolchildren’s Cognitive Activity with the Help of Various Interactive Technologies. World Applied Sciences Journal, 24(3), 340-344.

Lerner, I. (1971). Criteria for levels of cognitive independence of schoolchildren. New studies in pedagogical sciences, 4, 34-39.

Levin, E. (2008). Self-education of children at school: new methods. Rostov-on-Don: Fenix, 362 p.

Matyushkin, A. (2008). Problem situations in thinking and learning. Moscow: Directmedia Publishing, 312 p.

Petrova, I. (2011). Means and methods of formation of universal educational actions of a schoolchild. Young scientist, 5(2), 151-155.

Sandford, R. (2015). Ability to be active: exploring children's active play in primary schools. International Journal of Play, 2(4), 149-162.

Shchukina, G. (1999). Activation of cognitive activity of schoolchildren in the learning process: Manual for students of pedagogical universities. Moscow: Prosveshchenie, 273 p.

Sidenko, A. S. (2013). Types and peculiarities of pedagogical developments in conditions of introduction of the second generation standard into schools. Experiment and innovations at school, 5, 10-14.

Sviridova, E. (2013). Design, small study groups, individual trajectory in conditions of individualization of education. Municipal education: innovations and an experiment, 5, 44-51.

Thoonen, E. (2011). Can teachers motivate students to learn? Educational Studies, 3(37), 345-360.

Vorovshchikov, S. (2007). A school should teach to think, design, research: Administrative aspect: Pages written by management consultant and headmaster of the school. Moscow: «5 za znaniya», 274 p.

Vorovshchikov, S. (2010). Development of educational and informative competence of schoolchildren. Moscow: «5 za znaniya», 426 p.

Webster-Stratton, C. & Reid, J. (2004). Strengthening Social and Emotional Competence in Young Children—The Foundation for Early School Readiness and Success Incredible Years Classroom Social Skills and Problem-Solving Curriculum. Infants and Young Children, 2(17), 96–113. 

Cooper, R. K. & Sawaf, A. (1994). Executive EQ Emotional Intelligence in leadership and Organization. New York: Perigee Book, 358 p.

Ilusisova, S. M. & Kambarkisi, A. (2005). А. Features of social thinking in the pedagogical conflict. Bulletin KazNU, 2(15), 32-37.

Imig, S, Parker M., Roseboro D. L. &  Smith, R. (2012). The evolution of teacher candidates' thinking: coming to consciousness and developing conscience. Teaching and Learning, 26(2), 58-69.

Kovalchuk, L. (2014). Modeling of cultural and educational environment as a pedagogical condition of forming of professional thinking culture of future teachers. European Scientific Journal, 10(22), 69-81.

Law on Education of the Republic of Kazakhstan. (2007). Kazakhstan truth.  Almaty, 75 p.

Li-fang, Zh. (2004). Thinking styles: University Students' Preferred Teaching Styles and Their Conceptions of Effective Teachers. Journal of Psychology, 138(3), 233-252.

Morgan, A. M. (2012). Subject-specific literacies and transition in the middle years: examples of teacher thinking, research and practice. Literacy Learning: The Middle Years, 20(3), 39-51.

Perkins, D. Creating a Culture of Thinking. Educational Leadership. EBSCO. 2002; 98-99.

Rasumova, O.V. (2008). Future teachers’ subject and specific thinking formation: PhD Abstract. Kazan, KSU, 82 p.

Sadykov, T. S., Hmel, N. D., Zhampeisova, K. K.. (2000). Concept of pedagogical education of the Republic of Kazakhstan. Almaty: LEM. 15 p.

Salamatina, A. M. (2005). Junior students’ Technical Thinking Formation: PhD Abstract. Almaty: KazNPU, 25 p.

Saroj, V. (2006). Sex difference in thinking style of teachers trainees. IJPE, 37(2), 127-136.

Sarsekeyeva, Zh. Ye. (2011). Teacher’s professional thinking culture. Karaganda: KarSU publishing, 354 p.

Saxena, S., Jain, S. & Jain, R. (2013). Influence of forms of thinking styles on emotional intelligence of teacher educators. IOSR Journal of Research & Method in Education, 1(5), 30-33.

Sherlock, J. & Vesely, P. (2005). Pedagogical tools to develop critical thinking. Academic Exchange Quarterly, 9(4), 155-167.

The State Obligatory Standard of Education of the Republic of Kazakhstan. (2010). The higher professional education. Bachelor degree. Specialty 5B010200 – Pedagogics and a technique of elementary education, 31 p.

Toomela, A. (2007). Culture of science: strange history of the methodological thinking in psychology. Integrative Psychological and Behavioral Science, 41(1), 6-18.

Arriscado, A., Muros, M., Zabala, D., & Dalmau, T.  (2003). Influence of school health promotion on the life habits of schoolchildren. Anales de pediatria, 1(83), 11-18.

Atencio, M., Yi, C., Wee, T., & Yi, L. (2014). Using a complex and nonlinear pedagogical approach to design practical primary physical education lessons. European Physical Education Review, 20(2), 244-263.

Baena-Extremera, A. & Granero-Gallegos, A. (2015). Prediction model of Satisfaction with physical education and school. Revista de Psicodidactica, 20(1), 177-192.

Balsevich, V. (2006). Sports vector of physical education in the Russian schools: monograph. Moscow: Theory and Practice of Physical Culture and Sports, 326 p.

Bikmukhametov, R. (2004). Integration of spiritual and physical training of future teachers in the process of personal and professional development (Doctoral dissertation). Kazan: KSU, 263 p.

Bogdanov, M. (2007). Sport Education as a model of physical education classes. Bulletin of Tambov University: Humanities Series, 6(50), 42-45.

Boyle, S., Jones, G. & Walters, S. (2008). Physical activity among adolescents and barriers to delivering physical education in Cornwall and Lancashire, UK: A qualitative study of heads of PE and heads of schools. BMC Public Health, 8, 273.

Capel, S. (2010). Learning to Teach Physical Education in the Secondary School: A companion to school experience. Routledge, 236 p.

Chedov, К. (2004). Sports-oriented physical education in the context of training the Olympic reserves. Physical Training: Education, upbringing, training, 3, 45-46.

Darst, P. W. (2014). Dynamic physical education for secondary school students. Pearson, 152 p.

Deforche, B., Van Dyck, D., Deliens, T., & De Bourdeaudhuij, I.  (2015). Changes in weight, physical activity, sedentary behavior and dietary intake during the transition to higher education: a prospective study. The international journal of behavioral nutrition and physical activity, 12(16), 35-42.

Dolzhikova, T. A. (2011). Differentiated physical education of middle school-age children having different physical fitness levels: PhD thesis in Pedagogy. Krasnodar, 170 p.

Frolov, S. S. (2009). Information and computer technologies aimed to improve the educational process on the subject "Physical Training" at school: PhD thesis in Pedagogy. Tambov, 230 p.

Gavrilov, D., Komkov, A., & Malinin, A. (2005). Innovative technology aimed at psychophysical diagnostic of students: methodological recommendations. St. Petersburg: NO-IFC, 264 p.

Goranko, M. I., Kulnazarov, A. K., Kanagatov, E. B., & Koshaev, M. N. (2006). Presidential physical fitness tests – the fitness basis of the population of the Republic of Kazakhstan. Almaty: al Farabi, 68 p.

Gordiyash, I. A. (2009). The model of educational process aimed at the development of personal physical education in high school students: PhD thesis in Pedagogy. Volgograd, 173 p.

Gråstén, Arto. (2015). Secondary School Students' Physical Activity Participation Across Physical Education Classes: The Expectancy-Value Theory Approach. Physical Educator, 72(2), 340-346.

Gritskov, P. M. (2006). Pedagogical and metrological conditions of improving the regulatory framework of physical fitness of middle school-age children in the secondary school: PhD thesis in Pedagogy. Tambov, 187 p.

Jakimovich, V. (2002). Designing the system of physical education of children and youth based on personality-oriented education (Doctoral dissertation). Moscow, 382 p.

Khromin, E. (2005). Improving the efficiency of physical education of schoolboys based on their educational and training specialization. Theory and Practice of physical training, 8, 5-6.

Kim, S. (2006). Valeological-pedagogical maintenance of physical education in modern school  (Doctoral dissertation). St. Petersburg, 364 p.

Little, H. & Sweller, N. (2015). Affordances for Risk-Taking and Physical Activity in Australian Early Childhood Education Settings. Early Childhood Education Journal, 4(43), 337-345.

Locke, L. (1992). Changing Secondary School Physical Education. Quest -Illinois– National Association for Physical Education in Higher Education, 44(3), 361-372.

Lubysheva, L. (2002). Technology aimed at implementation of innovative projects with the view of improving physical education systems at the regional level. Physical training: upbringing, education, training, 3, 2-6.

Lubysheva, L., & Magin, V. (2003). The concept of professional training modernization for experts in physical training and sport. Theory and Practice of Physical Training, 12, 13-16.

Luke, M. (2000). Physical and health education curriculum: Cross-Canada perspectives. Cahperd, 2(66), 4-12.

Maher, A. J. (2016). Special educational needs in mainstream secondary school physical education: learning support assistants have their say. Sport, Education and Society, 21, 262-278.

Mandic, S., Bengoechea, E., Stevens, E., de la Barra, S., & Skidmore, P. (2012). Getting kids active by participating in sport and doing It more often: focusing on what matters. International journal of behavioral nutrition and physical activity, 9(86), 42-53.

Mantjes, J., Jones, A., Corder, K., Jones, N., Harrison, Griffin, S. & Sluijs, E. (2012). School related factors and 1yr change in physical activity amongst 9-11 year old English schoolchildren. International Journal of Behavioral Nutrition and Physical Activity, 9, 153-162.

Manzheley, I. (2005). Actualization of pedagogical potential of sports environment (Doctoral dissertation, Doctor of Education). Tyumen, 366 p.

Matveev, A. (2005). The concept of the structure and content of physical education at school. Physical training: upbringing, education, training, 6, 2-5.

McEvoy, E., Heikinaro-Johansson, P., & MacPhail, A. (2015). Physical education teacher educators’ views regarding the purpose(s) of school physical education. Sport, Education and Society, 6(13), 123-128.

Meinhardt, U., Witassek, F., Petro, R., Fritz, C., & Eiholzer, U. (2013). Strength Training and Physical Activity in Boys: a Randomized Trial. Pediatrics, 6(132), 1105-1111.

Ming, Li, Dibley, M., Sibbritt, M., & Yan, H. (2006). Factors associated with adolescents’ physical inactivity in Xi’an City, China. Australia: University of Newcastle, 428 p.

Misharov, N. (1993). Organizational-pedagogical conditions of improving physical fitness of students – participants of the program "Presidential contests": PhD Thesis in Pedagogic. Chelyabinsk, 210 p.

Moore, J., Schneider, L., Lazorick, S., Shores, K., Beighle, A., Jilcott, S., & Newkirk, J. (2010). Rationale and Development of the Move More North Carolina: Recommended Standards for After-School Physical Activity. Journal of Public Health Management and Practice, 16(4), 359-366.

Myzan, G. (1996). Sports Education: regional problems: monograph. Khabarovsk: Publishing house KhSPU, 320 p.

Nesterov, V. (1999). Formation and optimization of personal physical condition in the context of the Russian Far East (Doctoral dissertation of Education). Omsk, 352 p.

Nikolaev, J. (2005). The general theory and methodology of physical training: new contours – the human dimension. Theory and Practice of Physical Training, 11, 9-14.

Pelegrini, A., Silva, D., Petroski, E., & Glaner, M.  (2011). Health-Related Physical Fitness in Brazilian Schoolchildren: Data From The Brazil Sport Program. Revistabrasileira de medicina do esporte, 2(17), 92-96.

Peterson, P., Baker, E. & McGaw, B. (2010). Physical Education and Sports. International Encyclopedia of Education. Oxford: Elsevier Science Limited, 634 p.

Ponomarev, V. (2002). Pedagogical technologies of sports education of schoolchildren in the Far North (Doctoral dissertation). Tyumen, 374 p.

Rafalovich, A. B. (2009). Physical fitness testing and physical training of schoolchildren: Synopsis of thesis: PhD Thesis in Pedagogy. Malakhovka, 213 p.

Rodriguez, P. L., Garcia-Canto, E., Sanchez-Lopez, C., & Lopez-Minarro, P. (2013). Percepción de la utilidad de las clases de educación física y su relación con la práctica físico-deportiva en escolares. Cultura y Educacion, 1(25), 65-76.

Romanovich, B. & Svetovets, V. (2006). Sports-oriented physical education in the October school. Moscow: Publishing House of the ANO SRC "Theory and Practice of Physical Culture and Sport", 324 p.

Salov, V. (2001). Theoretical and methodological foundations of student healthy lifestyle of students through physical training (Doctoral dissertation, Doctor of Education). St. Petersburg, 420 p.

Siedentop, D. (1992). Thinking Differently about Secondary Physical Education. Journal of Physical Education, Recreation & Dance, 63(7), 69-77.

Sinelnikov, A., Hasty, P., & Sychev, A. (2000). Sport-oriented physical education at school: sports education. Theory and Practice of Physical Education, 6, 22-26.

Sollogub, S. (2003). Personality-oriented physical education of preschool children by means of complex diagnostics: PhD Thesis of Pedagogic. Smolensk, 160 p.

Stolyarov, V. (1997). "Non-classical" (humanistic) theory, program and model of youth sport. Sports, spiritual values and culture. Child sports (concepts, programs, technology). Moscow: Humanitarian Center "Sparta" RGAFK, 246 p.

Teleugaliev, B., Kulnazarov, A. & Tayzhanov, S. (2002). The subject "Physical Education". The state compulsory educational standards of the Republic of Kazakhstan: secondary education. Almaty: Rondo, 420 p.

Tinning, R. & Fitzclarence, L. (1992). Postmodern Youth Culture and the Crisis in Australian Secondary School Physical Education. Quest -Illinois– National Association for Physical Education in Higher Education, 44(3), 287-303.

Trudeau, F. & Shephard, R. (2010). Relationships of physical activity to brain health and the academic performance of schoolchildren. American journal of lifestyle medicine, 4(2), 138-150.

Ulstad, S. O. (2016). Motivation, Learning Strategies, and Performance in Physical Education at Secondary School. Advances in Physical Education, 6, 27-34.

Vishnevskiy, V. (2003). Behavioral features of students enrolled in various health-related educational institutions. Physical training: upbringing, education, training, 1, 47-52.

Zaitsev, G. (1998). Valeological-pedagogical foundations of human health in the educational system (Doctoral dissertation, Doctor of Education), St. Petersburg, 409 p.

Antsyferov, A. I. (2002). Electrodynamics and communication means operate at the very beginning of Quantum Physics. Moscow, Russia: Mnemozina, 264 p.

Atkins, P. W. & Friedman, R. S. (2005). Molecular Quantum Mechanics. Oxford University Press, 264 p.

Bennett, J. (2003). Teaching and learning science. A guide to research and its applications. London: Continuum, 253 p.

Bugayev, A. I. (1981). Methodology of teaching of physics at high schools. Moscow: Inlightening.

Dewey, J. (1990). Method in Science Teaching. Education in the field of natural sciences, 29(3), 119-123.

Dobson, K., Holman, J. & Roberts, M. (2001). Holt Science Spectrum: Physical Science. New York: Holt, 254 p.

Gibbons-Wood, D. & Lange, Т. (2000). Developing Core Skills: Lessons from Germany and Sweden. Education and Training, 42(1), 24-32.

Imashev, G. (2007a). Development of the technician - technological knowledge in a school course of physics. Atyrau, Kh. Dosmuhamedov Atyrau State University, 262 p.

Imashev, G. (2011). Innovative approaches in development of polytechnic education in the process of educating to physics at high school. Atyrau, Kh. Dosmuhamedov Atyrau State University. 353 p.

Imashev, G. (2012). Modern problems of polytechnic education the course of physics. Russian journal of Earth Sciences, 12(12), 53-57.

Imashev, G., Syrbayeva, S., Galimzhanova, M., Yergalieva, G. T., Muftakh, N. & Aldigulova, N. Z. (2014). The computer based technology of teaching quantum physics. Life Science Journal, 11(6), 102-105.

Le Bellac, M. A. (2006). Short Introduction to Quantum Information and Quantum Computation. Cambridge University Press.

Norenkov, I. P., & Zimin, A. M. (2004). Information technologies in education. Moscow, Publishing House MGTU, 257 p.

Rieffel, E., & W. Polak (2011). Quantum Computing: A Gentle Introduction. New York: The MIT Press, 362 p.

Ross, J. A. & Gray, P. (2006). Transformational leadership and teacher commitment to organizational values: The mediating effects of collective teacher efficacy. School Effectiveness and School Improvement, 17(2), 179-199.

Schunk, H. & Pajares, F. (2002). The development of academic self-efficacy. In A. Wigfield & J. Eccles (Eds.), Development of achievement motivation. San Diego: Academic Press, 16-31 p.

Shamalo, T. N. & Mekhnin, A. M. (2012). Forming value orientations of students during polytechnic training at physics lessons and extracurricular work. Pedagogical education in Russia, 5, 230-234.

Slastenin, V. A. (2002). Pedagogy: manual for higher educational pedagogic establishments.. Moscow: “Academy” publishing center, 273 p.

Tulkibayeva, N. N. (1995). Solving physics tasks: psychological and pedagogical aspect. Chelyabinsk: Publishing house of Chelyabinsk State Pedagogical University “Fakel” and Ural State Pedagogical University, 374 p.

Tzoneva, R. G. (2000). Application of LabVIEW technology in control engineering education. In Z. Pudlowski (Eds.). Proceedings of the 2nd Global Congress on Engineering Education, 154-167.

Zhazylbayeva N. & Salykbayeva Z. (2014). The "New Materials in Technology" elective course. Life Science Journal, 11(8), 73-75.

Aitzhanova, A. (2014). Kazakhstan 2050: Toward a modern society for all. Oxford: Oxford University Press, 259 p.

Aronson, A. & Pratkanis, A. R. (2003). Era of propaganda: Mechanisms of persuasion, everyday use and abuse. Saint Petersburg: EUROZNAK, 353 p.

Becker, G., Jors, K. & Block, S. (2015). Discovering the truth beyond the truth. Journal of pain and symptom management, 49(3), 646-649.

Davies, M. (2013). Critical thinking and the disciplines reconsidered. Higher Education Research & Development, 32(4), 529-544.

Goldacre, B. (2010). Bad Science. Moscow: Eksmo, Direct access: http://ru-psi.com/ru_zar/home_health/goldakr/0/.

Howard, L. W., Tang, T. L., & Austin, M. J. (2015). Teaching critical thinking skills: Ability, motivation, intervention, and the Pygmalion effect. Journal of Business Ethics, 128(1), 133-147.

Ivin, A. A. (1990). The art of right thinking. Moscow: Education, 355 p.

Ivin, A. A. (2001). Logic. Moscow: FAIR-PRESS, 296 p.

Johnson, R. H. (2014). The rise of informal logic: Essays on argumentation, critical thinking, reasoning and politics. V. 2. University of Windsor.

Karzhaubayev, E. K. & Sydykova, A. E. (2013). State and civil society institutes interaction in the republic of Kazakhstan. Middle-East Journal of Scientific Research, 14(4), 516-524.

Khalpern, D. (2000). Psychology of the critical thinking. Saint Petersburg: Piter, 352 p.

Linn, J. F. (2014). Kazakhstan 2050 Exploring an Ambitious Vision. Global Journal of Emerging Market Economies, 6(3), 283-300.

Maslach, C., & Jackson, S. E. (2013). A social psychological analysis. In G.S. Sanders & J. Suls (Eds.), Social psychology of health and illness. Cambridge: Consulting Psychologists Press, 227-251.

Melich, J. & Adibayeva, A. (2013). Nation-Building and Cultural Policy in Kazakhstan. European Scientific Journal, 2, 265-279

Paul, R. U. (1990). Critical thinking: What is necessary for each survival in rapidly changing world. Direct access: http://evolkov.net/critic.think/Paul.R/

Paul, R. & Elder, L. (2013). Critical thinking: Tools for taking charge of your professional and personal life. New York: Pearson Education, 265 p.

Popper, K. (1963). The Growth of Scientific Knowledge. London: Harper & Row, 253 p.

Ruggiero, V. R. (1990). Beyond the emotions and feelings: A guide to critical thinking. Direct access: http://evolkov.net/critic.think/Ruggiero.R/index.html

Salmon, M. H. (2012). Introduction to logic and critical thinking. London: Cengage Learning, 294 p.

Shiraev, E. B., & Levy, D. (2015). Cross-cultural psychology. London: Routledge, 254 p.

Spehr, S. & Kassenova, N. (2012). Kazakhstan: constructing identity in a former-Soviet society. Asian ethnicity, 13(2), 135-151.

Vaughn, L., & MacDonald, C. (2013). The power of critical thinking. Third Canadian Edition. Oxford: Oxford University Press, 285 p.

Wagner, J. (2014). Who belongs to me? Social relationship and personality characteristics in the transition to young adulthood. European Journal of Personality, 28(6), 586-603.

Antos, G. (1997). Text als Konstitutionsformen von Wissen. In G. Antos & H. Tietz (Eds.). Die Zukwnft der Text linguistic. Tubingen: Niemeyer, 253 p.

Auezov, M. O. (1965). The Path of Abai. Moscow: Fiction, 366 p.

Barkhaev, B. P. (2009). Pedagogical psychology. Saint Petersburg: Piter, 362 p.

Boldyrev, N. N. (2012). Problems of conceptual interaction in the process of verbal communication. In Language cognitive researches: Cognitive linguistics international congress on 10-12 October 2012. Moscow, Tambov: G.R. Derzhavin TSU publishing house, 39-45.

Brudnyi, A. A. (1998). Psychological hermeneutics. Moscow: Labirint, 263 p.

Burukina, O. A. (2011). Connotation – social intelligence. Cognitive linguistics issues, 2, 125-130.

Chernyavskaya, V. E. (2014). Text linguistics. Discourse linguistics. Moscow: Flinta-Nauka, 352 p.

Cowley, S. J. (2011). Distributed language. Amsterdam: John Benjamins, 368 p.

Doblaev, L. P. (1982). Semantic structure of the educational text and problems of its understanding. Moscow: Pedagogy, 274 p.

Dubrovskaya, O. G. (2014). Sociocultural context of the discourse activity subject’s knowledge. In E.I. Golovanova (Ed.), Language cognitive researcher: Language, understanding, culture. Moscow: Institute of Linguistic, RAS, 68-71.

Gadamer, N. S. (1967). Kleine schriften. Tubingen: Mohr, 256 p.

Gasparyan, G. G. & Chernyavskaya, V. E. (2014). Text as a discourse event. Cognitive linguistics issues, 4, 44-51.

Gunina, N. A. (2012). Revisiting the issue of the necessity for the context development method. In Language cognitive researches: Cognitive linguistics international congress on 10-12 October 2012. Moscow, Tambov: G.R. Derzhavin TSU publishing house, 255-258.

Harder, P. (2010). Meaning in Mind and Society: A Functional Contribution to the Social Turn in Cognitive Linguistics. Berlin: Mouton de Gruyter, 263 p.

Jackendoff, R. (2011). What is the human language faculty? Language, 87(3), 586-624.

Kubriakova, E. S. (1994). Text and its understanding. Russian text: the Russian-American journal on the Russian philology, 2, 18-25.

Kubriakova, E. S. (2012). On the “discourse” term and the knowledge structure behind it. In E. S. Kubriakova (Eds.), Searching for the essence of language: Cognitive researches. Moscow: Sign, 54-63

Lixin, Zh. (2012). The Inter-subjective model of conceptual blending and its interpretation of humor. In Language cognitive researches: Cognitive linguistics international congress on 10-12 October 2012. Moscow, Tambov: G.R. Derzhavin TSU publishing house, 154-155.

Luria, A. R. (2004). Lectures on general psychology. St. Petersburg: Piter: 262 p.

Minskiy, M. (1979). Frames for knowledge representation. Moscow: Energy, 142 p.

Musrepov, G. (1982). Ulpan is Her Name. Novel. Alma-Ata: Zhazushy, 167 p.

Sanbaev, S. (2009). Seasons of Our Life. Astana: Agroizdat, 275 p.

Sergaliev, M. (1987). My Peers. Almaty: Zhazushy, 262 p.

Spitzmuller, J. & Warnke, I. (2011). Diskurs linguistic. Eine Einfuhrung in Theorien und methoden der transtextuellen sprachanalyse. Berlin: W. Gruyter, 264 p.

Zappuvigna, M. (2012). Discourse of Twitter and Social Media: How we use language to create affiliation on the web. New York: Continuum International publishing group, 364 p.

Baydenko, V. I. (2006). Identifying the set of graduates’ competences as a necessary stage in the design of State Educational Standards for Higher Professional Education of new generation. Moscow: Education, 263 p.
Boud, D., & Molloy, E. (2013). Feedback in higher and professional education: understanding it and doing it well. London: Routledge, 253 p.
Danilova, O. V., Zinnatullina, N. D., & Timerbaeva, G. R. (2014). The formation of professional competence in students of technical universities through interdisciplinary integration. Journal Discussion", 5(46), 110-115.
Davletkaliev, D. K. (2015). Professional Competence Development of the Social Work Specialists in the Period of Study in the System of Additional Education. International Education Studies, 8(6), 83-88.
Garayeva, M. V. (2006). The formation of intercultural competence of specialists in modern Russian universities: PhD Thesis. Rostov-on-Don, Russia, 158 p.
Kargina, E. M. (2015). Professional Motivation Formation of Future Specialists under the Conditions of Regional Educational Complex. International Education Studies, 8(7), 44-56.
Kulikova, L. M., & Kulikov, L. M. (2012). The technique of forming professional competency of future expert in physical culture and sport during practical training. Sibirskiy pedagogicheskiy zhurnal, 2, 136-140.
Mikheeva, T. B. (2011).“Competence” and “competency”: the use of the concepts in modern Russian education. Bulletin of N. G. Chernyshevsky Transbaikal State humanitarian-pedagogical University. Series "Pedagogics and psychology", 5(40), 110-114.
Miroshnichenko, A. N. (2016). Organization resources’ management. What is competency and how to manage it? Direct access: http://free.megacampus.ru/xbookM0022/index.html?go=part-034*page.htm.
Mirzagitova, A. L., & Akhmetov, L. G. (2015). Self-Development of Pedagogical Competence of Future. Тeacher International Education Studies, 8(3), 114-121.
Spencer Jr. L., & Spencer, M. (2005). Competencies at work. Moscow: НІРРО, 252 p.
Syzdykbayeva, A. D. (2015). Formation of Research Competence of the Future Elementary School Teachers in the Process of Professional Training. International Education Studies, 8(4), 200-209.
Tang, S. Y., Wong, A. K. & Cheng, M. M. (1998). The Preparation of Highly Motivated and Professionally Competent Teachers in Initial Teacher Education. London: Lawrence Erlbaum Associates Publishers, 291 p.
Teasley, M. L., Archuleta, A., & Miller, C. (2014). Perceived Levels of Cultural Competence for School Social Workers. Journal of Social Work Education, 50(4), 694-711.
Trede, F., Macklin, R., & Bridges, D. (2012). Professional identity development. Studies in Higher Education, 37(3), 365-384.
Vasiutina, N. Y. (2016). Competences and competence approach to modern education. Direct access: http://festival.1september.ru/articles/581708/.
Voronina, L. A., Ivanova, N. E. & Ratner, S. V. (2008). Information culture as a factor of innovative development. Quality, innovation, education, 3, 8-11.
Zimniaia, I. A. (2005). A common culture and socio-professional competence of the person. Higher education today, 11, 14-20.

Annett, M. (1985). Left, Right, Hand and Brain: The Right Shift Theory. New-Jersey: Erlbaum Press, 174 p.
Chomsky, J. (1983). The Psychology of Language and Thought. Moscow: Plenum, 275 p.
Konopkin, O. A. (1995). Psychic Self-regulation of Voluntary Human Activity. Issues of Psychology, 1, 5-12.
Korneeva, S. A. (2011). Self-regulation Peculiarities of the Students with Different Lateral Organization Profiles: PhD Abstract. Moscow, 24 p.
Lopez, М. (1987). Differences Do Make a Difference. Direct access: http://www.al-edu.com/wp-content/uploads/2014/05/Lopez-1987-Differences-Do-Make-a-Difference-comparison-with-Milton-Erickson.pdf
Luria, А. R. (1932). The Nature of Human Conflicts. New York: Springer, 278 p.
Luria, A. R. (1973). The Basics of Neuropsychology. Moscow: AST, 264 p.
Moskvin, V. A. (2002). Interhemispheric Relations and Individual Distinctions Issue. Moscow: Nauka, 317 p.
Osnitsky, A. K. & Korneeva, S. A. (2014). New Aspects of the Study of the Conscious Self-regulation and Functional Brain Asymmetry. Educational Psychology, 9, 37-48.
Osnitsky, А. К. (2010). Psychological Mechanisms of Self-reliance. Obninsk: SOTSIN, 217 p.
Witkin, H. A. (1982). Cognitive Styles: Essence and Origins. Field Dependence and Field Independence. New York: Routledge, 312 p.

Bowen, G. M. (2016). Response to Section II: Practicing, Modeling, and Influencing Approaches to Teaching. New York: Springer International Publishing, 174 p.
Carpenter, J., & Dickinson, H. (2016). Interprofessional education and training. New York: Policy press, 245 p.
Entonado, F. B., & Díaz, L. A. (2006). A training proposal for e-learning teachers. European Journal of Open, Distance and E-learning, 9(2), 155-167.
Kalimullin, A. M., & Masalimova, A. R. (2016). Editorial: Actual issues of national education: Theory and practice. IEJME-Mathematics Education, 5, 242 -253.
Klarin, M. V. (1995). Innovations in the world pedagogics: training of the ground of research, games and discussions: Analysis of foreign experience. Riga: Experiment, 263 p.
Marasulov, A. F. (2008). Model of educational process and training of specialists. Journal of professional education, 3, 14-15.
Marasulov, A. F. (2010). Structural-logic generalized model of a specialist’s training and activity. In Priority tasks of directions of technical and scoeial-economic sciences. Republican interuniversity collection of scientific papers, 125-126.
Marasulov, A. F. (2014). Training model of future specialist in educational and production activity. Materials of Republican scientific-practical conference “Priority directions of educational process improvement in training of engineering-pedagogical personnel in a higher educational institution”. Shymkent: Kazakhstan engineering-pedagogical peoples’ friendship university, 4-5.
Markova, A. K. (1996). Psychology of professionalism. Moscow: Science, 352 p.
Passey, D., & Samways, B. (2016). Information Technology: supporting change through teacher education. New York: Springer
Popescu, A. M., & Stefan, M. A. (2014). Training the educator for methodological alternatives and paradigm changes in education. Revista de Stiinte Politice, 43, 171-183.
Poshayev, D. K. (2012). Teaching methodic of special disciplines. Astana: Nurbeine, 157 p.
Postnikova, P. G. (2004). Professional behavior of a teacher: psychological-pedagogical analysis. Journal of Pedagogics, 5, 61-63.
Radchenko, A. K. (1990). Teaching methodic of machine-building disciplines and industrial training. Training program for students of engineering-pedagogical specialty. Sverdlovsk: Education, 212 p.
Saipov, A. (2006). Theoretical-methodological fundamentals of pedagogical integration in the system of artistic-occupational training of a future teacher. Moscow: Institute of content and methods of education of Russian Academy of Education, 252 p.
Saipov, A., & Trigwell, K. (2015). Higher education teachers’ professional learning: Process and outcome. Studies in Educational Evaluation, 46, 92-101.
 State compulsory standard of education of the Republic of Kazakhstan. The higher education. Bachelor degree. (2008). Basic provisions”, approved by the order of the Minister of Education and Science of the Republic of Kazakhstan, 26-27.
Shalayev, I. K., Sazonova, L. I. (2004). Motivational program-objective management as a methodological knowledge in pedagogical processes. Journal of World of education – education in the world, 2, 16-23.
Smirnova, Ye. E. (1977). Formation ways of model of a specialist with higher education. Leningrad: LSU.
Zholdasbekova, S., Nurzhanbayeva, Z., Karatayev, G., Akhmet, L. S., & Anarmetov, B. (2016). The Conceptual Model of Future Teachers Training to Dual Education in Vet (Vocational Education & Training). International Journal of Environmental & Science Education, 11(7), 55-62.

Abylkhozhin, Zh., Kozybayev, M. & Tatimov, M. (1989). The Kazakhstan Tragedy. Questions of History, 7, 53-70.
Ananyeva, S. (2016). Classical Eastern and Kazakh Literature. Al-Farabi Kazakh National University Journal. Oriental Studies, 47, 2.
Deleuze, G. & Guattari, F. (2014). What is philosophy? New-York: Columbia University Press, 263 p.
Duncan, S. & Lolordo, A. (2013). Debates in modern philosophy: essential readings and contemporary responses. London: Routledge, 374 p.
Hegel, G. (1997). Science of Logic. Moscow: Nauka, 274 p.
Kartayeva, A. (2013). Traditions and Innovation in the History of Literature. Modern Problems of Science and Education, 4, 23-41.
Kaskabasov, S. (2013). Pushkin and Renaissance Abai-poets. Almaty: Zhan Publishing House, 373 p.
Kudayberdiev, Sh. (1990). The Genealogy of Turks, Kyrgyz, Kazakhs, and Khan Dynasties. Moscow: Dastan Joint Venture, 364 p.
Kudayberdiev, Sh. (1991). The Three Truths. Almaty: Zhan Publishing House, 366 p.
Kudayberdiev, Sh. (1994). On Being and The Soul. Abai, 9, 28-31.
Levitas, R. (2010). The Concept of Utopia. New-York: Peter Lang, 374 p.
Mahdi, M. (2015). Ibn Khaldun's Philosophy of History: A study in the Philosophic foundation of the science of culture. London: Routledge, 463 p.
Maytanov, B. (2004). Abai: History, Personality, Time. Almaty: Aruna.
Pochekayev, R. (2016). The Decree of Empress Anna and the Oath of Abul Khair Khan. New Voices in Translation Studies, 14, 46-73.
Qunanbayuli, A. (1993). The Book of Words. Beijing: EL, 274 p.
Shakarim, K. (1915). What Is Man? Almaty: Kazakhstan, 426 p.
Shakarim, K. (2007). My Father, The Son of Heritage. Shakarim Questions, 1, 145-242.
Sydykov, Ye. & Kurmanbayev, Ye. (2013). Addition to the Image: Abai – The Volost Governor. Reports of the National Academy of Sciences of the Republic of Kazakhstan, 2, 88-95.
Sydykov, Ye. (2012). Shakarim. Moscow: The Young Guard, 462 p.
Sydykov, Ye. (2014). The Correlation of Mental Braces of Life and Art of Abai and Shakarim. Reports of the National Academy of Sciences of the Republic of Kazakhstan, 2, 75-93.
Tapper, R. (2013). Tsars, Cossacks, and Nomads: The Formation of a Borderland Culture in Northern Kazakhstan in the Eighteenth and Nineteenth Centuries. International Journal of Turkish Studies, 19(2), 263.
Ulbrich, B. (2014). Book review: The National Element in Hermann Cohen’s Philosophy and Religion, written by Hartwig Wiedebach. European Journal of Jewish Studies, 8(1), 137-139.

Bazarbayeva, Z. (2008). Kazakh Intonation. Almata: Daik-Press, 1288 p.
Chomsky, N. (2006). Language and Mind. Third Edition. Massachusetts Institute of Technology. Cambridge University Press, 3, 209 p.
Dolgova, O. V. (1974). Halting Speech Semiotics. Мoscow: Moscow University Press, 608 p.
Flax, J., Lahey, M., Harris, K., & Boothroyd, A. (1991). Relations between proso  dic variables and communicative functions. Journal of Child Language, 18, 3–19.
Fletrcher, J. (2010). The prosody of speech: Timing and rhythm. The Handbook of Phonetic Sciences, 2, 521–602.
Fuchs, S., Petrone, C., Rochet, C. A., Reichel, U. D. & Koenig, L. L. (2015). Assessing respiratory contributions tof0 declination in German across varying speech tasks and respiratory demands. Journal of Phonetics, 52, 35–45. Elsevier.
Gooden, S. (2014) The Phonology of Intonation and Phrasing. In S.A. Jun (Eds.). Aspects of the Intonational Phonology of Jamaican Creole. Oxford University Press, 67-72.
Gussenhoven, C. & Jun, S.A. (2014). Complex Intonation Near the Tonal isogloss in the Netherlands. In S.A. Jun (Eds.). The Phonology of Intonation and Phrasing, 586 p.
Hancil, S. (2009). The Role of Prosody in Affective Speech.. Oxford: Wien, 260 p.
Hellbernd, N, & Sammler, D. (2016). Prosody conveys speaker’s intentions. Journal of Memory and Language, 88, 70–86.
House, J. (2009). Prosody and context selection: A procedural approach. York: University of York, 309 p.
Karlsson, A. M. (2014). The Phonology of Intonation and Phrasing. In S.A. Jun (Eds.). Oxford: Oxford University Press, 104 p.
Lieberman, P. (1985). Human speech and human language. New York: Plenum Press. 31 p.

Asylbekov, M. A. & Zharkenova, A. M. (2001). Population of Kazakhstan in the late nineteenth early twentieth centuries. Almaty: Orkeniet. 320 p.
Collection of information regarding. (1875). Orthodox missions and the activity of the Orthodox missionary society. 11, 50-51.
Dameshek, L. M. (1986). Domestic imperial policy and the peoples of Siberia in the nineteenth. early twentieth centuries. Irkutsk, IJP, 41 p.
DeWeese, D. (2010). Islamization and Native Religion in the Golden Horde. Hermeneutics: Studies in the History of Religions Series, 617 p.
Dmitriyev, S. S. (1966). The Orthodox Church and state during the pre-reform period. History of the USSR, 4, 361-387.
Dzhalilov, Z. G. (2006). Islam and the society in modern Kazakhstan. Almaty: Mir, 728 p.
Klimovich. L. (1936). Islam in Imperial Russia. Moscow: OGIZ, 406 p.
Kuznetsov, L. A. (1913). Brief historical essay on the town of Petropavlovsk. Petropavlovsk: Akmola, 732 p.
Melgunov, S. (1907). The church and the state in Russia. Moscow: AST, 182-189.
Missionary anti-Muslim collection. (1894). Missionary anti-Muslim collection.  Student works of the missionary anti-Muslim department of the Kazan Ecclesiastical Academy, 2, 308-332.
Missionary report. (1893). Orenburg Kray. 5, 69-81.
On the activity of missionaries. (1910). Speech, 635-645.
Pokrovsky, I. (1906). Orthodox theological encyclopedia. St.Petersburg: Peter, 580 p.
Sadvokasova, Z. T. (2005). Spiritual expansion of imperialism in Kazakhstan in the field of educational and religion. Almaty: Mir, 463 p.
Sergeyev, Yu. N. (1990). The Orthodox Church in Bashkiria – guide to the tsarist policy: Abstract of PhD in History dissertation. Kuybyshev, 32 p.

Abazov, R. (2007). Culture and customs of the Central Asian republics. Greenwood: Greenwood Publishing Group, 253 p.
Alimzhanova, A. S. (2015). Kazakhstan: The Choice of Civilizational Priorities. Mediterranean Journal of Social Sciences, 6(5), 153-160.
Ashwin, S. (2000). Gender, state, and society in Soviet and post-Soviet Russia. Moscow: Psychology Press, 352 p.
Azmukhanova, A. (2013). Aspects of intercultural dialogue in the post-Soviet time. Service in Russia and abroad, 2, 132-140.
Gu, M. L. (2011). Chinese culture and modernization. Available at SSRN 1924109, 23-41.
Heidegger, M. (2014). Introduction to metaphysics. Yale: University Press, 163 p.
Huffman, J. L. (2013). Modern Japan: an encyclopedia of history, culture, and nationalism. London: Routledge. 362 p.
Karipbayev, B. I., Razumov, V. I., & Soloshchenko, P. P. (2016). Traditions and perspectives of the socio-humanistic discourse in the Central Kazakhstan: International Training Conference, dedicated to the 20th anniversary of the faculty of Philosophy and Psychology at E. A. Buketov Karagandy State University. Omsk University "Vestnik", 1(79), 24-35.
Kerimbayev, N., & Akramova A. (2015). Kazakh History and Philosophy: the Ethnomathematical Component of the Content of Primary School Education in the Republic of Kazakhstan. Ppreprint archive: 1503.05418.
Kerimbayev, N., & Akramova, A. (2015). Kazakh History and Philosophy: the Ethnomathematical Component of the Content of Primary School Education in the Republic of Kazakhstan. arXiv preprint arXiv: 1503.05418.
Nicoll, L. (2004). Philosophy, Tradition, Nation. Scotland in Theory: Reflections on Culture & Literature, 1, 211-215.
Pieper, J. (2009). Leisure: The basis of culture; The philosophical act. California: Ignatius Press, 274 p.
Puzikova, S. M. (2015). Systems of Values of the Young People: Comparative Analysis of a Re¬se¬arch in China and Kazakhstan. Mediterranean Journal of Social Sciences, 6(1), 138-142.
Sadykov, K. A. (2014). The Young Independent State Philosophy Problem. Procedia-Social and Behavioral Sciences, 141, 791-794.
Sartre, J. P. (2015). Sketch for a Theory of the Emotions. London: Routledge, 253 p.
Suleimenov, Т. А. (2015). Development of philosophy in the post-Soviet Kazakhstan (methodological aspect). Eurasian Union of Scientists, 7(16), 41-49.
Tapper, R. (2013). Tsars, Cossacks, and Nomads: The Formation of a Borderland Culture in Northern Kazakhstan in the Eighteenth and Nineteenth Centuries. International Journal of Turkish Studies, 19(2), 63-72.
Tolen, Z. (2013). The Culture of Interethnic Concord in Kazakhstan: Peculiarities of Formation and Development. Proceedings of World Academy of Science, Engineering and Technology, 75, 152-163.
Wear, R. D. (1990). Nomads Versus Cultivators: a Cultural Analysis of the Western World Unknown Binding. London: ESP, 214 p.
Yeshpanova, D. D. & Kurmangaliyeva, G. K. (2014). Kazakhstan and Central Asia: the Turkic cultural heritage in the integration processes. Kazakhstan: Editor in Chief, 352 p.
Yessenbekova, U. M. (2016). Promotion of National Traditions by Kazakhstan Mass Media as a Mean of Ideological Influence. Indian Journal of Science and Technology, 9(9), 35-42.
Zatov, K. A. & Kantarbayeva, Z. (2015). Cultural traditions and innovations in modern Kazakhstan society. Kazakhstan National University "Vestnik" on Politology, Philosophy and Culturology, 1(50), 36-47.

Adams, M. (2012). Music and entertainment in post-Soviet Kazakhstan. (Doctoral dissertation), University of Illinois at Urbana-Champaign, 249 p.
Akhmetova, L. S. (2015) The Bologna process and UNESCO standards in Kazakhstan. PR and media in Kazakhstan. Volume of research papers, 9, 3-7.
Almetov, N. (2016). Realization of Didactic Potential of National Pedagogic in Pedagogical Process of School. Mediterranean Journal of Social Sciences, 7(1), 419-426.
Bergaliyeva, G. (1992). General pedagogy, history of pedagogy and education. Institute of Educational Pedagogy and Psychology, 19(5), 24-34.
Dyachenko, I. (2009). Theory and the training and education technique. The Relation Of Theory To Practice In Education, 2(1), 26-31.
Ebzhanova, К. The ways of getting higher education. PR and media in Kazakhstan, 9, 174-178.
Elpus, K. (2015). A Demographic Profile and Analysis of License Examination Scores. Journal of Research in Music Education, 63 (3), 314-335.
Illiasova, R. & Khalikova, K. (2014). Preparation teachers to development of students intelligent ability based on. International journal of experimental education, (2), 15-18.
Kuznetsova, E. (2010). Theory and the training and education technique. Theory and Methodology of Training, 10, 24-32.
Levchyk, N. (2011). Preparing schoolchildren to accomplish parental duties in the U.S.A and Great Britain. Kiy: Lotos, 250 p.
Lin, Hi. (2007). Methodical basis of conductor-choral preparation of students to work at school of China and Ukraine. Shanghai: Higher Education Press, 230 p.

Cvetkovski, R., & Hofmeister, A. (2014).  An Empire of Others: Creating Ethnographic Knowledge in Imperial Russia and the USSR. Budapest-New York: Central European University Press, 171 p.
Dmitriyev, V. A. & Popova, L. F. (2012).  The Russian Ethnographic Museum Exposition "The peoples of Central Asia and Kazakhstan", "The peoples of the South Caucasus" as the experience of a regional approach.  Museum. Traditions. Ethnicity, 2, 34-53.
Dmitriyev, S. V. (2012).  The Ethnographic Department Fund of the Russian Museum of the Foreign East Culture: Formation History and Fate. St. Petersburg: Faculty of Philology of the St. Petersburg State University, 373 p.
Fedoseyenko, O. F. (2001). The Russian Museum of Ethnography 1902-2002. St. Petersburg: Slavia, 426 p.
Hosking, G. (2014). History of Russia. From the Middle Ages to the October Revolution. Harvard: Harvard University Press, 362 p.
Kabdieva, S., & Yarmukhamedova, N. (2002). Contemporary art of Kazakhstan. Almaty: Soros Foundation-Kazakhstan, 264 p.
Lymer, K. (2014).  Nomads and networks: the ancient art and culture of Kazakhstan. Central Asian Survey, 33(1), 125-127.
Nikolenko, N. N. (2013). Ornament as a Symbol of Intercultural Communication. Middle-East Journal of Scientific Research, 17(4), 444-454.
Popova, L. F. (2002).  The Kazakh wedding saukele tires: the experience of the local classification. Museum. Traditions. Ethnicity. 20-21 centuries. Proceedings of the international scientific conference dedicated to the 100th anniversary of the Russian Museum of Ethnography. Saint Petersburg – Chisinau, 52-63.
Popova, L. F. (2008).  The peoples of Kazakhstan and Central Asia. The Slavs of Europe and the People of Russia. Dedicated to the 140th anniversary of the first ethnographic exhibition in 1876. St. Petersburg : The Russian Ethnographic Museum, 220-233.
Prishchepova, V. A. (2000).  Talking Collections. The history of MAE collections related to the Central Asia and Kazakhstan. St. Petersburg: MAE, 251 p.
Prishchepova, V. A. (2011).  Exemplary collections of the Central Asian nations of the second half of 19th – early 20th century in the collections of the Kunstkamera Museum. St.Petersburg: Science, 352 p.
Reference book. (2003). The system of scientific description of the museum items: classification methodology, terminology. St.Petersburg: Publisher "Art Suite".
Rohwer, S., Drovetski, S. V. & Wood, C. S. (2001).  Bird specimens in the Burke Museum from Russia and Kazakhstan. Ornithologia, 29, 260-281.
Said, E. W. (2003).  Orientalism. Camberwell: Penguin Books, 250 p.
Stasevich, I. V. (2008).  The Kazakh Traditiona culture in the Kunstkamera collections. Almaty: Institute of Cultural Policy and Art Studies, 173 p.
Stasevich, I. V. (2011).  The social status of women among the Kazakhs: traditions and modernity. Direct access: http://www.kunstkamera.ru/lib/rubrikator/08/08_03/mae_xxxiv/
Tapper, R. (2013).  Tsars, Cossacks, and Nomads: The Formation of a Borderland Culture in Northern Kazakhstan in the Eighteenth and Nineteenth Centuries. International Journal of Turkish Studies, 19(1), 263-265.
Thompson, J. M. (2012).  Russia and the Soviet Union: A Historical Introduction from the Kievan State to the Present.  Boulder: Westview Press, 416 p.
Vishnevetskaya, V. A. (1989).  From the history of the Central Asian-Kazakh MAE collections. St.Petersburg: MAE, 426 p.
Yerofeeva, I. (1998).  Kazakhstan under the power of the Russian Empire. In History of Kazakhstan, 81-92

Aneesh A., Hall, L. & Petro, P. (2015). Beyond Globalization: Making New Worlds in Media, Art, and Social Practice. Journalism & Mass Communication Quarterly, 92(1), 245-247.

Baytenov, E. (2004). Religious and Mythological Notions as the Foundation of Memorial Architecture. The Memorial Architecture of Kazakhstan: Evolution and Problems of Formation, 42-56.

Beisenbayev, S. (2014). Aesthetic-Artistic Features of the National Color in Modern Kazakhstan Arts. GISAP: Culturology, Sports and Art History, 4, 23-25.

Bolatova, D. (2014). The Felt Manufacturing Technology. Engineering Sciences – from Theory to Practice. Collection of Materials of the 25th International Scientific and Practical Conference, 8(21), 119-124.

Darmenova, R. (2016). Formation cultural art of students in the conditions of studying features of national clothes. WALIA Journal, 32(1), 7-9.

Dzhelbuldin, Y. & Jeteyeva, D. (2014). Traditions and Customs of Kazakhs. Bloomington: Authorhouse, 180 p.

Edelbay, S. (2012). Traditional Kazakh Culture and Islam. International Journal of Business and Social Science, 3(11), 122-133.

Erkin Z. (2013). History of Handicraft in Pavlodar Region. Middle-East Journal of Scientific Research, 14(9), 1230-1234.

Frank, V. (2006). The Eurasian People of Saka. Almaty: Dayk-Press, 248 p.

Koshayev, V. (2010). Stages of Development and the Technologies of Decorative and Applied Art, In Z. Anipenko (Eds.). Decorative and Applied Art: Concepts. Stages of development, 234-259.

Kunanbay, A. (2003). The Soul of Kazakhstan. Saudi Aramco World, 54 (3), 20-33.

Malinova, R. & Malina, Ya. (1988). Fabric Manufacturing. A Jump to the Past. An Experiment Reveals Ancient Secrets, 80-89.

Marlugan, A. (1986). Kazakh Folk Applied Art. Almaty: Oner, 256 p.

Mazhitayeva, S. (2015). Semiology of Kazakh Ornaments. Review of European Studies, 7(6), 170-182.

Mukanov, M. (2015). Cultural Phenomenon of Aesthetic Minimalism in Copyright Tapestries Alibi and Saule Bapanova. Mediterranean Journal of Social Sciences, 6(1), 658-665.

Shamigulova, A. T. (2015). Vocabulary of Clothes and Jewelry in Studies of Turkic Languages (From the History of the Study of the Issue). Mediterranean Journal of Social Sciences, 6(5), 194-200.

Somhegyi, Z. (2013). Wide perspectives Contemporary arts in Central Asia. Contemporary Practices Art Journal, 14, 70-75.

Tsagarayev, V. (2000). History, Mythology, Art, Semantics. Vladikavkaz: Gassiev Republican Publishing and Printing Company, 300 p.

Usmanova, E. (2010). Kazakh Women’s Garments in the Bronze Age. Karaganda: Lisakovsk, 252 p.

Yatsenko, S. (2015). The Costume of Iranian-Language Nations in Ancient Times and Methods of its Historical and Cultural Reconstruction. Moscow: Nanka Publishers, 47 p.

Yurievna, Y. & Doroshenko, T. (2016). Traditions of art and craft decoration and architecture of kazakh yurt as a source of modern art. European Journal of Science and Theology, 12(3), 221-232.

Zhogova, M. &, Sheromova, I. (2014). The Synthesis of Technologies and Traditions in the Modern Fashion Industry by the Example of Felting in Clothes Design. Modern Problems of Science and Education, 4, 118-126.

Zhukenova, Zh. (2012). The Ensemble and Artistic-Visual System in the Kazakh Folk Art. Moscow: Medline-C, 229 p.

Alefirenko, N. F. (2014). Linguistic cultural studies. Moscow: Nauka.

Altunina, Ye. R. (2013). Social psychology. Moscow: Urait.

Ananyev, B. G. (1980). Selected psychological works. In A.A. Bodalev (Eds.), Moscow: Pedagogy.

Austin, J. L. (1986). The Theory of Speech Acts. Novelties in Foreign Linguistics, 7, 22-130.

Bachman, L. (1990). Fundamental Considerations in Language Testing. Oxford: Oxford University Press.

Bogoyavlensky, D. N. (1969). Mental activity techniques and their development in schoolchildren. Voprosy Psychologii, 6, 21-26.

Brown, G., & Yule, G. (1989). Discourse analysis. Cambridge: Cambridge university Press.

Canale, M., & Swain, M. (1980). Theoretical bases of communicative approaches to second language teaching and testing. Applied Linguistics, 1, 1-47.

Catch, B., J. (1972). The abstraction of Linguistic Ideas. Cognitive Psychology, 2, 331-350.

Churilina, L. N. (2013). Relevant problems of modern linguistics. Moscow: Flinta.

Copper, T. (1977). Text and Context: Explorations in the Semantics and Pragmatics of Discourse. London: Longman.

Davydov, V. V. (1986). The problems of developing education. Moscow: Znanie.

Dzhadrina, M. Zh. (2000). The scientific framework for designing the content of variative education in school. Almaty: Al-Farabi Kazakh National University.

Elkonin, D. B. (1978). Game psychology. Moscow: Pedagogy.

Galperin, P. Ya. (1966). The psychology of thinking and the teaching of gradual development of mental actions. Studies of Thinking in Soviet Psychology. Moscow: Enlightenment.

Grice, H. P. (1975). Logic in conversation. Syntax and semantics, 3, 41- 58.

Hymes, D. (1972). Toward ethnography of communicative events. In P.P. Giglioli (Eds). Harmondsworth.

Jacks, A. H., & Katarina L. (2015). Auditory Masking Effects on Speech Fluency in Apraxia of Speech and Aphasia: Comparison to Altered Auditory Feedback. Journal of Speech, Language, and Hearing Research, December, 58, 1670-1686.

Kon, I. S. (1978). The discovery of "Self". Moscow: Enlightenment.

Kostyuk, G. S. (1988). Selected psychological works. In L.N. Prokashenko (Eds.). Moscow: Pedagogy.

Krasnykh, V. V. (2012). Basic psycholinguistics. Moscow: Gnosis.

Krutetsky, V. (1998). The Psychology of Schoolchildren's Mathematical Abilities. Moscow: Institut prakticheskoi psihologii.

Krysko, V. G. (2013). Social psychology. Moscow: Urait.

Kulibayeva, D. N. (2006). The methodologist. The fundamentals of managing the educational system of international schools. Almaty: Kazakh Ablai Khan University of International Relations and World Languages.

Leontyev, A. A. (1974). Problems and methods of psycholinguistics in interpersonal communication. Studies of Speech and Thinking Activity. Psychology, 111, 3-11.

Menchynskaya,  N. A.  (1978). Problemy  uchenyia  i  razvytyia.  Problemy  obshchei, vozrastnoi  y  pedahohycheskoi  psykholohyy In V. V. Davydova (Eds.). Moscow: Pedahohyka.

Musatayeva, M. Sh. (2012). Theoretical and methodological aspects of studying text linguistics. Almaty: Al-Farabi Kazakh National University.

Passov, Ye. I. (1991). The communicational method of teaching foreign speech. Moscow: Znanie.

Pavlov, V. T. (1979). The problems of child psychology. Voprosy Psychologii, 5, 12-36.

Pesina, S. A. (2014). Invariability in modern linguistics and language philosophy. Moscow: Flinta.

Raven, D. (1975). Series "Advances in Discourse Processes". In J. Sinclair & R. Coulthard (Eds.), Towards an Analysis of Discourse: the English Used by Teachers and Pupils. Oxford: Oxford University Press.

Rubinstein, S. L. (1989). Basic general psychology. Moscow: Enlightenment.

Ryzhakov, M. V. (1999). The key competencies for Europe. Standards and Monitoring in Education, 2, 12-24.

Salkhanova, Zh. Kh. (2013). Competence and competencies. Almaty: Al-Farabi Kazakh National University.

Samarin, Yu. A. (1962). Essay on the psychology of the mind. The characteristics of schoolchildren's mental activity. Moscow: Publishing House of the Academy of Pedagogical Sciences of the Russian Soviet Federative Socialist Republic.

Searle, J. R. (1969). Speech Acts. An Essay in the Philosophy of Language. Cambridge.

Sechenov, I. M. (2001). The elements of though. St.Petersburg: Piter.

Sevington, S. (1989). Problems of discourse. Cambridge.

Shishov, V. D. (2003). Personality-oriented paradigms of education. National Education, 2, 34-54.

Slastenin, V. A. (2003). Introduction to pedagogical axiology. Moscow: Enlightenment.

Talyzina, N. F. (1987). Ways of developing a specialist's profile. Saratov: State Technical University of Saratov.

Tarone, E. (1984). Teaching speech communication. Tallinn: Tallinn university of technology.

Utebaliyeva, G. Ye., & Yesbulatova, R. M. (2015). Strategic competence as a research object in linguistics. Al-Farabi Kazakh National University Journal, 4, 54-56.

Vygotsky, L. S. (1982). Thinking and speech. Moscow: Enlightenment.

Cannon, C. & Buttell, F. (2014). Institutional Review Boards at Very High Research Activity Universities: An Opportunity for Social Workers. Research on Social Work Practice, 25(7), 45-54.

Cheung, J. (2015). An exploration of social workers' role in remunerative vocational training: Caring, controlling, or contractual? Qualitative Social Work, 15(2), 102-112

Deglau, E., Ray, A., Conway, F., Carree-Lee, N., Waldman, W., Cunningham, K., Harrison, T., Bales H. & Powell. T. (2015). Practice change in child welfare. Journal of social work education, 51, 153-172.

Dodds, I. (2010). Global problems of social work at the international level. Social work, 2, 54-59.

Druzhinina, A. (2012). Resources of educational environment in the  formation of management culture of students as future social care workers. Tambov University “Vestnik” Humanities series, 6 (110), 100-107.

Facchini, C., & Tonon Giraldo, S. (2012). The University Training of Social Workers. British Journal of Social Work, 43(4), 57-68.

Firsov, M. (2007). Theory of Social Work. Moscow: VLADOS.

Garashkina, N. (2004). Designing university social education. Tambov: Mir.

Garashkina, N. (2012). The system of university training of future social care workers as a component of social education. Tambov University “Vestnik” Humanities series, 6(110), 91-100.

Kapskaya, A., L. Volynskaya, Karpenko, A., & Filipchuk, V. (2003). Professional communicative competence as a condition for interaction between a social care worker and a client. Moscow: CSM.

Karpenko, A. (2004). Professional formation of a social care worker. Moscow: СSM.

Karpenko, A. (2007). The professional training of social care workers in the conditions of university education. Drohobych: Krug.

Kleyberg, Yu. (2006). Theoretical approaches to the nature and purpose of psychology and social work. Human factor: The problems of psychology and ergonomics, 1, 37-39.

Kremneva, T. (2005). Social Care Worker training abroad. Social Work, 1, 46-49.

Kulichenko, R. & Simonovich, B. (2009). Social education as a component of the global educational space. Modern problems of science and education, 4, 52-54.

Kurbatov, V. (2003). Social work. Rostov-on-Don: Myisl.

Malmberg-Heimonen, I., Natland, S., Toge, A. & Hansen, H. (2015). The Effects of Skill Training on Social Workers’ Professional Competences in Norway. British Journal of Social Work, 1, 18.

Markov, A. (1996). Psychology of professionalism. Moscow: Znanie.

Minzhanov, N. (2012). Legal Pedagogy in the Republic of Kazakhstan. Karaganda. Karaganda Kazpotrebsoyuz Economic University.

Minzhanov, N., Mulikova, S., Abdakimova, M. & Kenzhebayeva, S. K. (2013). Training of Social Care Workers. Karaganda: KEUK.

Mukhametzyanova, F. (2000). Social services specialist training in the region. Kazan: Institute of Secondary professional vocational education of Russian Academy of Education.

Panov, A. (1995). Social work as a science, a professional activity and a university major. Social Work, 9, 32-38.

Platonova, N. (2011). Innovations in social work: manual for students of vocational education institutions. Moscow: "Academia" Publishing Center.

Ramon, S. & Sarri, R. (1996). Social Work training: Tradition and Innovation. Moscow: Aspekt Press.

Rimmer, A.,& Harwood, K. (2004). Citizen participation in the education and training of social workers. Social Work Education, 23(3), 309-323.

Ring, C.  (2014). Social Work Training or Social Work Education? Social Work Education, 33(8), 1101-1108.

Rock, L. & Corbin, C. (2007). Social work students' and practitioners' views on the need for training Caribbean social workers in disaster management. International Social Work, 50(3), 383-394.

Roh, C.Y., Moon, M., Yang, S.-B. & Jung, K. (2015). Linking Emotional Labor, Public Service Motivation, and Job Satisfaction. Social Work in Public Health, 31(2), 1-15.

Scurlock-Evans, L. & Upton, D. (2015). The Role and Nature of Evidence. Journal of Evidence-Informed Social Work, 12(4), 369-399.

Shmeleva, N. (2005). Personality formation and development of a social care worker as a professional. Moscow: Dashkov & Co.

Sitnikov, A. (1996). Theory. Methods. Psychotechnology. Moscow: Technology Business School.

Skutneva, S. (2006). Strategies of youth identity formation in professional life. Sotsis, 10, 56-68.

Smith, A. (2005). Ethno-symbolism and the Study of Nationalism. Nations and Nationalism: A Reader, 23-31.

Starshinov, A. (2008). Trends in Education in Social Work. Ural State University “Izvestiya”, 38, 69-80.

Telyatnikov, G. (1990). Situational role play as a professional development factor of students. Abstracts of the III International Scientific Conference "Development of students' creative thinking through interactive teaching methods". Kalinin: Myisl.

Topchiy, L. (1997). Problems of professional skills formation of experts in social work. Social Care Worker, 2, 214-222.

Tsui, M.-S. (2015). Education and training for professional practice. China Journal of Social Work, 8(2), 91-92.

Usmanova, B. (2009). Social Innovation: Manual (3rd edition). Moscow: Sotsium.

Webber, M., Currin, L., Groves, N. & Fernando, N. (2010). Social Workers Can e-Learn: Evaluation of a Pilot Post-Qualifying e-Learning Course in Research Methods and Critical Appraisal Skills for Social Workers. Social Work Education, 29(1), 48-66.

Zhalagina, T. (2003). The results of the group work on overcoming signs of professional deformation of a university professor. Society and Power: The collection of scientific papers. Tver: ChuDo.

Decree of the President of the Russian Federation "On the National Security Strategy of Russian Federation until 2020" of 12.05.2009. (2016) Retrieved on March 2016, from www.consultant.ru

Demenishin, A. V. (2011). On some topical security issues as a legal category. St. Petersburg: Renome, 242p.

Medvedev, D. A. (2010). Standards of Democracy and Criteria of Efficiency: speech in Yaroslavl. Retrieved from www.gpfyaroslavl.ru / about / yaroslavl2010.

Galuzin, A. F. (2007). Legal security as an independent kind of security. Law and Politics, 12, 117-125.

Horney, K. (1991). Final Lectures. New York: Norton, 128 р.

Il'ichev, L. F., Fedoseyev, P. N., Kovalev, S. M. & Panov, V. G. (1983). Philosophical Encyclopedic Dictionary. Moscow: Soviet Encyclopedia, 840 p.

Ivanov, V. G., Barabanova, S. V., Shagieva, R. V., Chikisheva, N. M., Lunev, A. N., Volkova, N. V., Nabiullina, K. R. & Spirina, E. V. (2016). The Essence and Content of State Regulation of Services Development in Conditions of Increasing Autonomy of Federal State Entities. International Review of Management and Marketing, 6(2), 149-154.

Kelzen, H. (1967). The Pure Theory of Law. Berkeley, Los Angeles: University of California Press, 356 p.

Kostromicheva, M. V. (2010). About a uniform understanding of the rights’ terms: publicity. The effectiveness of law-making and enforcement of law, Eagle: ORAGS, 327 p.

Kuznetsov, S. A. (2000). Great Dictionary of Russian language. St. Petersburg: "Norint", 1536.

Law of the Russian Federation "On safety" of 28.12.2010. (2016). Retrieved on March 2016, from www.consultant.ru

Lunev, A. N., Pugacheva, N. B. & Stukolova, L. Z. (2014). Development strategies for professional educational services under the increasing autonomy of territories within the federal state. Actual Problems of Economics, 160(1), 215-220.

Maslow, A. H. (1959).  New Knowledge in Human Values. New York: Harper & Row, 268 р.

Montesquieu, Sh. L. (1999). The Spirit of Laws. Moscow: Thought, 674 p.

Murray, Н. L. (2007). Explorations in Personality. New York: Oxford Academ, 810 р.

Ozhegov, S. I. (2011). Explanatory Dictionary of the Russian language. Moscow: OOO "Publishing house Onyx", 736 p.

Petrova, T. N., Kirillova, O. V., Sokolova, S. G., Pugacheva, N. B., Galimullina, A. F., Maksimova, O. G., Antonova, T. V. & Kozhanov, V. V. (2016). Education as the Management of Research Universities Students' Socialization. International Review of Management and Marketing, 6(2), 28-33.

Prokhorov, A. M. (1970). Great Soviet Encyclopedia. Moscow: Soviet Encyclopedia, 640 p.

Pugacheva, N. B., Kirillova, T. V., Ovchinnikova, I. G., Kudyashev, N. K., Lunev, A. N., Pavlova, O. A., Kashina S. G. & Valeyev A. S. (2016b). The Mechanism of State-Public Management of Vocational Education in the Region. International Review of Management and Marketing, 6(2), 6-11.

Pugacheva, N. B., Ezhov, S. G., Kozhanov, I. V., Kozhanova, M. B., Ogorodnikova, S. V., Oshaev, A. G., Timonin, A. I. & Goloshumova, G. S. (2016a). The model of self-realization readiness formation of research universities students in the process of civic education. International Review of Management and Marketing, 6(1), 128-133.

Shafirov, V. M. (2004). Right in the human dimension, Jurisprudence, 3, 213-215.

Stoudmann, J. (2016). "The human dimension" - a cornerstone of a comprehensive security concept Retrieved from www.old.nasledie.ru/ipravo/20_10/21_1/article.php?art=8

Terentyeva, I. V., Mukhomorova, I. V., Perezhogina, O. N., Pugacheva, N. B., Lunev A. N., Akhmetzyanova, G. N., Lezhnin, V. V. & Gainullina, R. R. (2016). Development Strategy of Service Sector in Conditions of Federal States Entities Autonomy Increasing. International Review of Management and Marketing, 6(2), 1-5.

Yepaneshnikov, V. V., Pugacheva, N. B., Goloshumova, G. S., Kuznetsova, V. V., Dobrovolskaya, L. V., Moiseeva, L. V., Garaganov, A. V. & Litvinenko, N. A. (2016). Pedagogical Management of Civil Education of Research Universities Students. International Review of Management and Marketing, 6(2), 23-27.

Batsyn, V. K. & Butyagina, K. L. (2005). Formation of the market of textbooks in the Russian Federation: the role of Education Innovation Project. Moscow: Logos, 196 p.

Beilinson, V. G. (1986). Arsenal of education: characteristics, preparation, designing of textbooks. Moscow: Book, 286 p.

Bespal'ko, V. P. (1988). The theory of the textbook. Moscow: Pedagogy. 160 p.

Kamasheva, Y. L., Goloshumova, G. S., Goloshumov, A. Y., Kashina, S. G., Pugacheva, N. B., Bolshakova, Z. M., Tulkibaeva, N. N. & Timirov, F. F. (2016). Features of vocational education management in the region. International Review of Management and Marketing, 6(1), 155-159.

Lerner, I. Y. (1983). Textbook functions and ways of fixing in it of the educational material. Moscow: Pedagogy, 350 p.

Magdanov, P. V. (2010). The integration of structural-functional and program-oriented approaches to management. Retrieved in June 2016, from http://cyberleninka.ru/article/n/integratsiya-strukturno-funktsionalnogo-i-programmno-tselevogo-podhodov-k-upravleniyu

Nazarova, T. S. & Gospodarik, Y. P. (2005). Strategy of development of educational books. Psychology, 3, 11-19.

Petrova, T. N., Kirillova, O. V., Sokolova, S. G., Pugacheva, N. B., Galimullina, A. F., Maksimova, O. G., Antonova, T. V., Kozhanov, V. V. (2016). Education as the Management of Research Universities Students' Socialization. International Review of Management and Marketing, 6, 28-33.

Pugacheva, N. B., Kirillova, T. V., Ovchinnikova, I. G., Kudyashev, N. K., Lunev, A. N., Pavlova, O. A., Kashina, S. G. & Valeyev, A. S. (2016a). The Mechanism of State-Public Management of Vocational Education in the Region. International Review of Management and Marketing, 6, 6-11.

Pugacheva, N. B., Ezhov, S. G., Kozhanov, I. V., Kozhanova, M. B., Ogorodnikova, S. V., Oshaev, A. G., Timonin, A. I., Goloshumova, G. S. (2016b). The model of self-realization readiness formation of research universities students in the process of civic education. International Review of Management and Marketing, 6, 128-133.

Rakhimov, A. Z. (1991). Logical and psychological concept of the development of school textbooks. Moscow: Education, 239 p.

Rosenberg, N. M. (1986). Textbook for secondary vocational schools: structure, content, ways to improve. Moscow: Higher School, 235 p.

Smirnov, V. I. (2000). On the evolution of the role and functions of the textbook. Education Science, 1(3), 206-217.

Tupalsky, N. I. (1976). The main problems of university textbooks. Minsk Higher School. 183 p.

Tyurina, L. G. (1998). University textbook: today and tomorrow. Higher education in Russia, 1, 12-24.

Yepaneshnikov, V. V., Pugacheva, N. B., Goloshumova, G. S., Kuznetsova, V. V., Dobrovolskaya, L. V., Moiseeva, L. V., Garaganov, A. V. & Litvinenko, N. A. (2016). Pedagogical Management of Civil Education of Research Universities Students. International Review of Management and Marketing, 6, 23-27.

Zuyev, D. D. (1983). School textbook. Moscow: Pedagogy. 238 p.

Adrain, T. & Hyun S. S. (2010). “Liquidity and Leverage”. Journal of Financial     Intermediation, 19, 418 – 37.

Barbier, E. (1987). “The Concept of Sustainable Economic Development”. Environmental Conservation 14(2), 101–110.

Doff, R. (2008). “A Critical Analysis of the Solvency II Proposals”. The Geneva Papers on Risk and Insurance – Issues and Practice 33, 193 – 206.

Doppelt, B. (2003). Leading change toward sustainability. Sheffield: Greenleaf Publishing, 325 p.

Dyllick, T. & Hockerts, K. (2002). Beyond the business case for corporate sustainability. Business Strategy and the Environment, 11(2), 130–141.

Groppelli, A. A., Ehsan N. (2000). Finance. Barron's Educational Series, 445.

Porter M.E. (2004). Competitive advantage: creating and sustaining superior performance. New York: Free Press, 252 p.

Sandström, A. (2006). “Solvency: Models, Assessment and Regulation.” Florida: Chapman & Hall, 433 p.

Blanchard, O. (2008). Cracks in the system. Repairing the damaged global economy. Finance and Development, 45 (4), 8-10. 

Dyatlov, S. A. (1995). Information paradigm of socio-economic development. Izvestia of Saint-Petersburg University of economy and Finance, 3, 17-30.

Dyatlov, S. A, Vasiltsova, V. M.,Vasiltsov, V. S., Bezrukova, T. L. & Bezrukov, B. A. (2015a). Methodology of Management Innovation Hypercompetition. Asian Social Science,  11(20), 166-169.

Dyatlov, S. A. (2015b). Entropy Economics. Research Methodology of the Global Crisis. St.Petersburg, 74-81.

Dyatlov, S. A. (2015c). Entropy Economics. Research Methodology of the Global Crisis. St.Petersburg, 139-143.

Hirai, T. (2015). Financial globalization and the instability of the world economy Capitalism and the World Economy. The Light and Shadow of Globalization, 27-45.

Krugman, P. R. (2009). Return of a great depression? Moscow: Eksmo, 296 p.

Nanda, N. (2008). Expanding frontiers of global trade rules: The political economy dynamics of the international trading system. Expanding Frontiers of Global Trade Rules. The Political Economy Dynamics of the International Trading System, 1-193. 

Nort, D. (2010). Understanding of process of economic changes. Moscow: IDES of “HSE”, 17 p.

Thurow, L. K. (1999). The future of capitalism: how current economic forces shape the world of tomorrow. Novosibirsk: Nauka, 166 p.

Toumashev, A. R., Toumasheva, M. V., Valeev, E. R. & Miasnikov, D. A. (2015). Development of Russian economy in conditions of globalization and investment policy. Mediterranean Journal of Social Sciences, 6(3), 700-704.

Ushakov, D., Chich-Jen, S. (2014). Global economy urbanization and urban economy globalization. Urbanization and Migration as Factors Affecting Global Economic Development, 148-170. 

White, W. R. (2015).  System malfunction: The global economy is rife with imbalances that cannot be fixed under the present international monetary (non)system. Finance and Development, 52 (1), 44- 47. 

Whiting R. (2013). Crisis and Transformation in Modern Britain, 1945-2009. Procedia Social and Behavioral Sciences, 77,  139-148. 

Arcelus, F. J. (1984). An extension of shift-share analysis. Growth and Change, 15 (1), 3-8.

Artige, L., Neuss, L., (2015).  A New Shift-Share Method. Growth and Change, 45 (4), 667-683.

Barff, R. & Prentice, L. K. (1988). Dynamic Shift-Share Analysis. Growth and Change, 19 (2), 1–10.

Becker, G. S. (2007). Health as human capital: synthesis and extensions. Oxford Economic Papers, 59, 379–410.

Beer, E. & Clower, T. (2014). Mobilizing leadership in cities and regions. Regional Science, 1(1), 5-20.

Courvisanos, J., Jain, A. & Mardaneh, K. (2015). Economic Resilience of Regions under Crises: A Study of the Australian Economy. Regional Studies, 50 (4), 1-15. 

Détang-Dessendre, C., Partridge, M. D. & Piguet, V. (2016). Local Labor Market Flexibility in a Perceived Low Migration Country. Regional science and urban economics, 348.

Dunn, E. S. (1960). A Statistical and Analytical Technique for Regional Analysis. Papers in Regional Science, 6(1), 97-112.

Esteban-Marquillas, J. M. (1972). A Reinterpretation of Shift-Share Analysis. Regional and Urban Economics, 2 (3), 249-261.

Faggio, G., Silva, O. (2014). Self-employment and entrepreneurship in urban and rural labour markets. Journal of Urban Economics, 84, 67–85

Freedman, D. A., & Stark, P. B. (2003). “What is the Probability of an Earthquake?” in Earthquake Science and Seismic Risk Reduction, NATO Science Series IV: Earth and Environmental Sciences. Retrieved from http://www.stat.berkeley.edu/~stark/Preprints/611.pdf

Harris, T. R., Gillberg, C. B., Narayan, R., Shonkwiler, J. S. & Lambert, D. K. (1994). A Dynamic Shift Share Analysis in Nevada Economy. Technical Report, 1(5), 74-85

Miljaeva L. G. & Prokolov M. V. (2014). Methods of rapid diagnosis of the employment policy of the population of the administrative-territorial units. Bulletin of the University of Omsk. “Economy” series, 4, 102–108.

Moshkov A. V. (2015).  Structural Shifts in Industrial Production in the Pacific Regions of Russia. Scientific notes Transbaikal State University. Series: natural sciences,  1 (60), 98-106.

Navarro-Espigares, J. L., Martín-Segura, J. A. & Hernández-Torres, E. (2012). The role of the service sector in regional economic resilience. The Service Industries Journal, 32 (4), 571-590.

Oduro-Ofori, E. (2011). The role of local government in local economic development promotion at the district level in Ghana. Dortmund: Technical university Dortmund, 274 p.

Owyang, M. T., Piger, J. & Wall, H. J. (2013).  Discordant city employment cycles. Regional Science and Urban Economics, 43(2), 367-384.

Redfearn, C. L. (2009). Persistence in urban form: The long-run durability of employment centers in metropolitan areas. Regional Science and Urban Economics, 39 (2), 224-232.

Romer, P. M. (1990). Endogenous Technological Change. Journal of Political Economy, 98(5), 71-102.

Taleb, N. N. (2007). Black swans and the domains of statistics. The American Statistician, 61(3), 198-200.

Travers, T. (2012). Local government’s role in promoting economic growth: removing unnecessary barriers to success.  London: Local Government Association? 342p.

Wall, H. J. (2013). The employment cycles of neighboring cities. Regional Science and Urban Economics, 43 (1), 177-185.

Alatis, J. E. (1989). Language teaching, testing, and technology: Lessons for the past with a view toward the future. Washington, D.C: Georgetown University Press, 263 p.

Asher, J. J. (1969). The Total Physical Response Approach to Second Language Learning. The Modern Language Journal, 53(1). 3–17.

Atkinson, E., Conboy, I., Atkinson, J., Doods, A., & McInnis, C. (1996). Evaluation of the open learning initiative: Tertiary, access to through a national brokerage agency. University of Melbourne, 267 p.

Bandler, R. & Grinder, J. (1981). Reframing: Neuro-Linguistic Programming and the Transformation of Meaning, Real People Press. 300 p.

Bonner, S. (1999). Choosing Teaching Methods Based on Learning Objectives: An Integrative Framework. Issues in Accounting Education, 14(1), 11-39.

Bonwell, C. C., & Eison, J. (1991). Active learning: Creating excitement in the classroom. Washington, DC: The George Washington University School of Education and Human Development.

Byram, M. (1989). Cultural studies in foreign language education. Philadelphia: Multilingual Matters. 250 p.

Cottel, P.G., & Millis, B.J. (1993). Cooperative structures. Issues in Education, 8(1), 40–60.

Gardner, H. (1984). "Heteroglossia: A Global Perspective". Interdisciplinary Journal of Theory of Postpedagogical Studies 5, 172–180.

Gardner, H. (2002). "Interpersonal Communication amongst Multiple Subjects: A Study in Redundancy". Experimental Psychology 10, 72–80.

Gatteno, K. (1963). Teaching Foreign Languages in Schools: The Silent Way. Reading, UK: Educational Explorers, 150 p.

MacIntyre, P. D. & Gardner, R. C. (1991). Language anxiety: Its relation to other anxieties and to processing in native and second languages. Language Learning, 41, 513-34.

Pennycook, A. (1990). Critical pedagogy and second language education. System 18, 303-314.

Seale, J., & Mence, R. R. (2001). An Introduction to Learning Technology within Tertiary Education in the UK, Oxford Brookes University, Headington. 360 p.

Waterhouse, L. (2006). "Multiple Intelligences, the Mozart Effect, and Emotional Intelligence: A critical review". Educational Psychologist 41(4), 207–225.

Wesche, M., & Ready, D. (1985). Foreigner talk in the university classroom. Input in second language acquisition,89-114.

Zane, L. B., & Muilenburg, L. (2000). Design discussion questions for online, adult learning. Educational Technology, 40(5), 53−56.

Abdullin, E. B. (1990). Methodological analysis of the problems of music pedagogy in the higher education system. Moscow: Prometheus, 252p.

Allsup, R. E. & Olson, N. (2012a). New educational frameworks for popular music and informal learning: Anticipating the second-wave. In S. Karlsen & L. Väkevä (Ed.), Future Prospects for Music Education: Corroborating Informal Learning  Pedagogy. Cambridge, UK: Cambridge Scholars, 11-21.

Allsup, R. E. & Olson, N. J. (2012b). New Educational Frameworks for Popular Music and  Informal  Learning:  Anticipating  the  Second-Wave.  In  Karlsen,  S & Väkevä, L. (Eds.). Future  Prospects for  Music  Education:  Corroborating  Informal  Learning  Pedagogy. Cambridge Scholars Publishing, 11–21

Allsup, R. E. & Westerlund, H. (2012). Methods and situational ethics in music education. Action, Criticism, and Theory for Music Education 11(1), 124–48.

Bakhtizina, D. I. (2006). The truth of music (Doctoral dissertation). Sibay: Sibay institute of Bashkir State University, 225 p.

Bergson, A. (1998). Creative Evolution. Moscow: Canon-Press, 263 p.

Berleant, A. (2012). The Music in My Philosophy. Direct access: http://www.aesthetics-online.org/newsletter/32.3.pdf

Berleant, A. (2004). Re-thinking Aesthetics, Rogue Essays on Aesthetics and the Arts. Aldershot: Ashgate, 178 p.

Custodero, L.  & Williams, L. (2000). Music for Everyone: Creating Contexts for Possibility in Early Childhood Education. Early Childhood Connections 6(4), 36-43.

Fichte, J. G. (1792). Attempt at a Critique of All Revelation. New York: Cambridge University Press, 1978.

Galbershtam, А. М. (2002). Problems of the musician performer's stage reflection. Problems and prospects of the musician teacher's professional training: psychological and axiological aspects. Proceedings of VI International Research and Practice Conference. Moscow: MSPU, 118-121

Golitsin, G. A. (1989). Reflection in science and learning. Collection of scientific articles. Novosibirsk: Science, 355 p.

Hegel, G. W. (1803). Critical Journal of Philosophy, Watsburg, 252 p.

Izard, C. E. (2006). The Psychology of Emotions.. St Petersburg: Peter Publishing House, 163 p.

Kant, I. (1788). Critique of Practical Reason. Direct access: http://www.loyalbooks.com/book/critique-of-practical-reason-by-immanuel-kant.

Kolysheva, T. A. (1997). Preparation of the teacher of music for professional reflection on the system of the higher pedagogical education. Moscow: Education, 326 p.

Kratus, J. (2007). Music Education and the Tipping Point, Music Educators Journal, 94(2), 42-48.

Kulyutkin, Yu. N. & Sukhobskaya, G. S. (1996) Personality: inner world and self-realization. Ideas, concepts, attitudes. St. Petersburg: Tuscarora.

Lektorskiy, V. А. (1980). Subject, object, cognition. Moscow: Science, 163 p.

Leontyev, D. A. (2007). Psychology of meaning: Nature, structure and dynamics of semantic reality. Moscow: Mysl, 252 p.

Neuhaus, H. G. (1988). On the art of piano playing. Moscow: Music. 263 p.

Nietzsche, F. (1982). Daybreak. Cambridge: Cambridge CUP, 252 p.

Rickles, D. (2013). Musicology as an Object for HPS? An Exploration Whither Philosophy of Musicology? Journal of Aesthetics and Art Criticism, 33(2), 1089-1668.

Rubinstein, S. L. (2001). Basics of general psychology. St. Petersburg: Petersburg, 252 p.

Rudneva, О. S (2003). Methodological bases for the art teacher training. Moscow: Education, 351 p.

Schippers, H. & Campbell, P. S. (2012). Cultural diversity: Beyond songs from every land. In G.McPherson, and G.Welch, (Eds.), Oxford handbook of music education, 87-104.

Swanwick, K. (1988). Music, Mind, and Education. New York: Routledge, 259 p.

Toropova, А. V. (2010). Music psychology and psychology of music education. Moscow: Graf-Press, 166 p.

Tsypin, G. M. (1994). Psychology of musical activities: problems, judgements, opinions: In Handbook for students of pedagogical institutes and conservatories, 218-220.

Yakovleva, L. E. (1991). Formation of readiness of the future teacher to pedagogical reflection (Doctoral dissertation). Moscow, Moscow State University, 442 p.

Yurova, Т. V. (2005). Conditions to develop the pedagogical reflection of a music teacher in the process of professional improvement (Doctoral dissertation). Chita, Buryat Pedagogical Institute, 474 p.

Aronson, A. (1990). The impact of polyharmonic loading on durability and fatigue resistance in corrosive medium. Problems of Strength, 7, 45-48.

Astafiev, V. I., Fedorchenko, D. G. & Tzypkaikin, I. N. (1996). Complex stress-time cycles influence on aircraft engine parts fatigue strength. Proceedings of the Sixth International Fatigue Congress, 96, 499-504.

Baklacioglu, T., Onder T., & Hakan A. (2015). Dynamic modeling of energy efficiency of turboprop engine components using hybrid genetic algorithm-artificial neural networks. Energy, 86, 709-721.

Bartelds, G. (1997). Aircraft Structural Health Monitoring, Prospects for Smart Solutions from a European Viewpoint. Structural Health Monitoring, Current Status and Perspectives, 293–300.

Birger, I. A. (1984). Strength calculation of the aircraft gas-turbine engines. Moscow: Engineering, 208 p.

Coffin, L. F. (1976). The Prediction of Wave Shape Effect in Time-Dependent Fatigue. Proceeding on the 2 International conference on Behavior of Materials, 866-870.

Cowan, R. S., & Winer, W. O. (1999). Research Developments in Integrated Diagnostics and Prognostics. Structural Health Monitoring, 237–246.

Falaleev, S., Chaadaev, K. & Diligenskiy, D. (2014).Selection of the hydrodynamic damper type for the turbomachine rotor. Life Science Journal, 11(7), 502-505.

Fedorchenko, D. G. (2014). Simulation of real loading conditions in designing the high-durability turbo machines using high-level models. Bulletin of Irkutsk State Technical University, 6, 78-86.

Fedorchenko, D. G. (2015). Development of methods and systems of GTE end-of-life control in operation. Bulletin USATU, 19(1-67), 55-61.

Hached, S. (2014). Novel, remotely controlled, artificial urinary sphincter: A retro-compatible device. Transactions on Mechatronics, 19(4), 1352-1362.

Harvey, D. Y. (2015). Structural Health Monitoring Software for Aerospace, Civil, and Mechanical Infrastructure. Los Alamos: Los Alamos National Laboratory, 266 p.

Herrera, C., Yepifanov, S., & Loboda, I. (2011). A comparative analysis of turbine rotor inlet temperature models. Proceedings of ASME 2011 Turbo Expo: Turbine Technical Conference and Exposition. American Society of Mechanical Engineers, 3, 317-327.

Kogayev, V. P., & Drozdov Y. N. (1991). Strength and durability of machine parts. Moscow: Higher school, 319 p.

Krivenyuk, V. (2009). Forecasting the Long-Term Strength of Heatproof Nickel Alloys. Metal and Casting in Ukraine, 11(12), 20-25.

Kudva, J., Grage, M., & Roberts, M. (1999). Aircraft Structural Health Monitoring and Other Smart Structures Technologies-Perspectives on Development of Future Smart Aircraft. Palo Alto: Technomic Publishing. Structural Health Monitoring, 106–119.

Kulyk, M., Kucher, O., & Miltsov, V. (2011). Mathematical models of the calculation of aircraft structural reliability. Aviation, 15(1), 11-20.

Kuznetsov, N. D. (1989), Engineering methods of aeroelastic phenomena study at turbomashinery vibration development. Proceedings of International conference on Engineering aero-hydroelectricity, 405 – 409.

Mouhat, O., Khamlichi, A., & Limam, A. (2015). Reliability analysis of buckling limit state for friction stir welded aircraft stiffened panels. Key Engineering Materials, 640, 35-42.

Novikov, D. (2014). Development of Squeeze Film Damper Characteristics Calculation Methods Which Take into Account a Liquid Inertia Forces. Research Journal of Applied Sciences, 9(10), 649-653.

Tzeytlin, V. I., & Fedorchenko D. G. (1980). Assessment of component durability under the combined impact of repeated static and vibration loading. Problems of Strength, 1, 14-17.

Varadan, V. K., & Varadan, V. V. (1999). Wireless Remotely Readable and Programmable Microsensors and MEMS for Health Monitoring of Aircraft Structures. Palo Alto:Technomic Publishing. Structural Health Monitoring, 96–105.

Vronsky, G. ( 2004). Modified complete cycle method and schematization of multidimensional loading processes. TsAGI Scientific Notes, 35(1-2), 97-109.

Wiseman, M. W., & Guo, T. H. (2001). An investigation of life extending control techniques for gas turbine engines. Proceedings of the IEEE American Control Conference, 5, 3706-3707.

Yepifanov, S. V., Ring, N. A., Glikson, I. L. & Shankin, S. I. (2013) Modernization of the "rain" method for the end-of-life monitoring of GTE main components. Aerospace Engineering and Technology, 9(106), 173-176.

Belousov, A. I. & Nazdrachev, S. V. (2014). Methodology of modernizing the serial converted gas turbine unit. Russian Aeronautics, 57(4), 378-382.

Bogard, D. G. & Thole, K. A. (2006). Gas turbine film cooling. Journal of Propulsion and Power. 22(2), 249-270.

Donus, F., Bretschneider, S., Schaber, R. & Staudacher, S. (2011). The architecture and application of preliminary design systems. Proceedings of the ASME, 6, 801-810.

Ermakov, A. I., Shklovets, A. O., Popov, G. M. & Kolmakova, D. A. (2014). Investigation of the effect of the gas turbine compressor supports on gas flow circumferential nonuniformity. Research Journal of Applied Sciences, 9(10), 684-690.

Falaleev, S. V. & Balyakin, V. B. (2014). Application of a hydrogasdynamic axial vibration damper for reducing GTE vibration. Russian Aeronautics. 57(3), 314–318.

Kolmakova, D. A., Baturin, O. V., Popov, G. M. (2014a). Knowledge lack impact assessment of the source date on numerical simulation results of operational process in axial flow turbine blade row. ARPN Journal of Engineering and Applied Sciences, 9(12), 2880-2889.

Kolmakova, D., Baturin, O., Popov, G. (2014b). Effect of manufacturing tolerances on the turbine blades. ASME 2014 Gas Turbine India Conference, New Delhi. 17 December 2014.

Kolmakova, D., Popov, G., Shklovets, A., Ermakov, A. (2014). Techniques and methods to improve the dynamic strength of gas turbine engines compressor rotor wheels. ASME 2014 Gas Turbine India Conference, GTINDIA 2014; New Delhi. 17 December 2014.

Kuz'michev, V. S., Rybalko, V. N., Tkachenko, A. Y. & Krupenich, I. N. (2014b). Optimization of working process parameters of gas turbine engines line on the basis of unified engine core. ARPN Journal of Engineering and Applied Sciences. 9(10), 1873-1878

Kuz'michev, V. S., Tkachenko, A. Y., Krupenich, I. N. & Rybakov, V. N. (2014a). Composing a virtual model of gas turbine engine working process using the CAE system "ASTRA". Research Journal of Applied Sciences, 9(10), 635-643.

Makhavikou, V., Kasper, R. & Vlasenko, D. (2014). Method of model reduction for elastic multibody systems. Barcelona: Notta, 1009 p.

Matveev, V. N., Popov, G. M., Goryachkin, E. S., Smirnova, Y. D. (2014). Effect of accounting of air bleed from the flow passage of the multi-stage axial low pressure compressor on its design performances. Research Journal of Applied Sciences, 9(11), 784-788.

Melentjev, V. S., Gvozdev, A. S. (2014). Methods of building a parametric CADmodel of a piston micromotor with the systems. International Journal of Engineering and Technology, 6(5), 2331-2338.

Oberkampf, W. L., Trucano, T. G., Hirsch, C. (2004). Verification, Validation and Predictive Capability in Computational Engineering and Physics. Applied Mechanics Reviews, 57, 345-384.

Ryazanov, A., Urlapkin, A. & Chempinskiy, L. (2013). Realization of technique of creation 3D parametric model of GTE standard parts. Journal "Izvestia SNC RAN", 15(4), 949-954.

Sargison, J. E. & Guo, S. M. (2002). A converging slot-hole film-cooling geometry. Journal of Turbomachinery. 124(3), 461-471.

Setoguchi, T. & Takao, M. (1996). Effect of Guide Vanes on the Performance of a Wells Turbine for Wave Energy Conversion. International Journal of Offshore and Polar Engineering. 8(2), 155-160.

Takao, M., Setoguchi, T. (2000). Performance of wells turbine with 3D guide vanes. Proceedings of the International Offshore and Polar Engineering Conference, 1, 381-386.

Thakker, A. & Jarvis, J. (2009). Conceptual design of the next-generation impulse turbine using the Pugh decision-matrix. Materials and Design. 30(7), 2676-2684.

Wasfy, T. & Noor, A. (2003). Computational strategies for flexible multibody systems. Applied Mechanics Reviews, 56(6), 553-613.

Xiao, Y. X. & Sun, D. G. (2012). Numerical analysis of unsteady flow behaviour and pressure pulsation in pump turbine with misaligned guide vanes. IOP Conference Series: Earth and Environmental Science, 15(3), 032-043.

Andam, Z. R. (2014). e-Commerce and E-business. Direct access: https://en.wikibooks.org/wiki/E-Commerce_and_E-Business

Camarinha-Matos, L. M., Afsarmanesh, H., & Rabelo R. (2013). E-business and Virtual Enterprises: managing business-to-business. New York: Springer, 245 p.

Distributed information systems (2013). Direct access: http://5fan.ru/wievjob.php?id=48479

Distributed systems review. (2016). Direct access:  http://www.uran.donetsk.ua/~masters/2008/fvti/prihodko/library/dist2.htm

Galiev, A. (2012). E-commerce in Kazakhstan: a true boom? Direct access: http://www.computerworld.kz/articlekz/3646/.

Gorozhankin, K. (2014). Who helps the e-commerce in Kazakhstan make money. Forbes Kazakhstan, 37, 44-46

Harold, A. (1999). JavaBeans. Moscow: Lori, 163 p.

Hass, Ch., Bichler, M., & Guler K. (2013) Optimization-based decision support for scenario analysis in electronic sourcing markets with volume discounts. Electronic Commerce Research and Applications, 2(3), 152-165.

Karpov, L. E. (2007). Software distributed systems architecture. Мoscow: MAX Press, 132 p.

Kintonova, A. Zh. & Bigalieva, A. (2015). The implementation technologies of distributed systems. Science and Education” digest at the 10th International Scientific conference of Students and young Researchers (pp. 1096-1100). Astana.

McLean, S., Haftel, J., Williams, K. (2003). Microsoft .NET Remoting. Мoscow: “Russian Editorial” Publishing, 384 p. 

Methods and ways of developing distributed systems using Java. (2014). Direct access: http://old.mkgt.ru/files/materials/878/lecture1.pdf

Mikov, A. I. & Zamyatina, E. B. (2007). Distributed systems and algorithms. Lecture course. Direct access: http://window.edu.ru/resource/466/57466

Nikabadi, M. S., & Jafarian, A. (2015). Effect of Necessary Factors for Deploying E-Business Models on Business Performance and Supply Chain Performance in Auto Industry. Technological Solutions for Sustainable Business Practice in Asia, 1, 153.

Radchenko, G. I. (2012). Distributed computing systems. Chelyabinsk: Mir, 226 p.

Rosales, J. H., Torres, G., & Ramos, M. (2015). A Middleware for Integrating Cognitive Architectures. Brain Informatics and Health: 8th International Conference, BIH 2015, London, 353-357.

Rozanski, N., & Woods, E. (2012). Software systems architecture: working with stakeholders using viewpoints and perspectives. London: Addison-Wesley, 256 p.

Sarsenov, S. (2016). Informational Kazakhstan-2020. Direct access: http://strategy2050.kz/ru/page/gosprog4

Tanenbaum, A. & Van Steen, M. (2003). Distributed systems. Principles and paradigms. St. Petersburg: Peter, 877 p.

Verissimo, P., & Rodrigues, L. (2012). Distributed systems for system architects. Springer Science & Business Media, 1, 22-34.

Vershinin, M. M., & Ivanova, E. B. (2003). Java 2, Enterprise Edition. Design and development technologies. St. Petersburg: BHV-Petersburgh, 317 p.

Zhumagaliev, A. (2011). Digital Communications Kazakhstan. Deirect access: http://digitalcom2011.kz/

Kettle, A., & Winterbourn,  С. (1997). Myeloperoxidase: a key regulator of neutrophil oxidant production. Redox Rep, 3, 3-15.

Klebanoff, S. (2005). Myeloperoxidase: friend and foe. J Leukoc Biol, 77, 598-625.

Konkabaeva, A., & Bazelyuk, L. (2002). Cytochemical indicators of myeloperoxidase activity and catecholamine content in the blood of postpartum women living in areas adjacent to the Semipalatinsk nuclear test site. Probl Med Chem, 48, 293-295.

Kutter, D., Devaquet, P., Vanderstocken, G., Paulus, J. M., Marchal, V., & Gothot, A. (2000). Consequences of total and subtotal myeloperoxidase deficiency: risk or benefit ? Acta Haematol, 104, 10-15.

Malle, E., Marsche, G., & Arnhold, J. (2006). Modification of low-density lipoprotein by myeloperoxidase-derived oxidants and reagent hypochlorous acid. Biochim Biophys Acta, 1761, 392–415.

Namazbaeva, Z., & Bazelyuk, L. (2014). Evalution of the respiratory system of teenagers in urban areas. Journal Health Solar labor and medical ecology, 2(43), 42-48.

Panasenko, O., Chekanov, A., Arnhold, Y., Sergienko, V., Osipov, A., & Vladimirov, Y. (2005). Formation of free radicals during hydroperoxide decay in the presence of myeloperoxidase or activated neutrophils. Biochemistry, 70,1209–1217.

Panasenko, O., Osipov, A., & Schiller, J. (2002). Interaction of exogenous hypochlorite and hypochlorite produced in the MP system + H2O2 + silica with unsaturated phosphatidylcholine. Biochemistry, 67, 1071-1084.

Rakhmanin, Y., & Litvinov, N. (2004). Scientific bases of prenosological diagnostics of homeostasis disorders in the presence of chronic chemical loads. Hyg Sanit, 6, 48-50.

Revich, B., Sergeyev, O. & Hauser, R. (2006). Dioxins, furans and PCBs in the blood of adolescents living in Chapayevsk – the first results of a prospective epidemiological study. Toxicol Bull, 5, 2-8.

Ruf, J., & Carayon, P. (2006). Structural and functional aspects of peroxidase. Arch Biochem Biophys, 445, 269-277.

Titov, V. (2007). Microalbuminuria – the test showing "littering" of the intercellular environment of the human body by the "biological waste" with low molecular weight. Biochemistry, 12, 3-15.

Furtmüller, P. G., Burner, U., & Obinger, C. (1998, Dec). Reaction of myeloperoxidase compound I with chloride, bromide, iodide, and thiocyanate. Biochemistry, 37, 17923-17930.

Shiohara, M., & Komiyama, A. (2000). Myeloperoxidase deficiency. Ryōikibetsu shōkōgun shirīzu, 7, 183-185.

Pattison, D. I., & Davies, M. J. (2006). Reactions of myeloperoxidase-derived oxidants with biological substrates: gaining chemical insight into human inflammatory diseases. Curr Med Chem, 13, 3271-3290.

Galijasevic, S., Abdulhamid, I., & Abu-Soud, H. M. (2008, Apr). Potential role of tryptophan and chloride in the inhibition of human myeloperoxidase. Free Radic Biol Med, 15(44), 1570-1777.

Nauseef, W.  M. (2014, Jan). Diagnostic assays for myeloperoxidase and myeloperoxidase deficiency. Methods Mol Biol, 1124, 537-546.

Banks, P. A., & Freeman, M. L. (2006). Practice Guidelines in Acute Pancreatitis. The American Journal of Gastroenterology 101(10), 23–79.

Banks, P. A., Bollen, Th. L., Dervenis, Ch., Gooszen, H. G., Johnson, C. D., Sarr, M. G., Tsiotos, G. G., & Vege, Santhi S. (2013). Classi Fi Cation of Acute Pancreatitis — 2012. Gut, 62(1), 102-11.

Beger, Hans G., & Rau Bettina M. (2007). Severe Acute Pancreatitis. Clinical Course and Management, 13(38), 5043–5051.

Bennett, G. L., & Balthazar, E. J. (1998). Imaging of Acute and Chronic Pancreatitis in Hepatobiliary and Pancreatic Radiology. In G.S. Gazelle, S. Sai, P.R. Mueller (Eds.). New York: Thieme, 1238 p.  

Bertin-Maghit, M., Goudable, J., Dalmas, E., Steghens, J. P., Bouchard. C., Gueugniaud, P. Y., Petit. P., & Delafosse, B. (2000). Time Course of Oxidative Stress after Major Burns. Intensive Care Medicine 26(6), 800–803.

Besselink, M. G., VanSantvoort, H. C., Boermeester, M. A., Nieuweohuijs, V. B., VanGoor, H., Dejong, C. H, C., Schaapherder, A. F., & Gooszen, H. G. (2009). Timing and Impact of Infections in Acute Pancreatitis. British Journal of Surgery 96(3), 267–273.

Boyko, V. V., Krivoruchko, I. A., Shevchenko, R. S., Smachilo, R. M., & Pesotsky, O. N. (2002). Acute Pacreatitis. Pathophysiology and Treatment, 7, 47-52.

Bradley, E. L. (1993). Clinically Based Classification System for Acute Pancreatitis. Arch Surg, 128, 111-121.

Büchler, M. W., Gloor, B., Müller Ch. A., Friess, H., Seiler, Ch. A., & Waldemar, Uhl. (2000). Acute Necrotizing Pancreatitis: Treatment Strategy according to the Status of Infection. Annals of Surgery, 232(5), 619–626.

Chak, A., Hawes R. H., Cooper, G. S., Hoffman, B., Catalano, M. F, Wong, R. C. K., Herbener, Th. E., & Sivak M. V. (1999). Prospective Assessment of the Utility of EUS in the Evaluation of Gallstone Pancreatitis. Gastrointestinal Endoscopy 49(5), 599–604.

Connor, S., Raraty, M. G. T., Howes. N., Evans, J., Ghaneh, P., Sutton, R., & Neoptolemos, J. P. (2005). Surgery in the Treatment of Acute Pancreatitis. Scandinavian Journal of Surgery, 94(6), 135–142.

Dröge, W. (2002). Free Radicals in the Physiological Control of Cell Function. Physiological Reviews 82(1), 47–95.

Ersoz, N., Ozler, M., Topal, T., Uysal, B., Poyrazoglu, Y., Simsek, K., Gocgeldi, E., & Korkmaz, A. (2016). The Effect of Ozone Treatment on Experimental Colon Anastomosis in Rats. European Surgery 48(2), 122–128.

Ferreira, F. L., Bota, D. P., Bross, A., Mélot, Ch., & Vincent, J. L. (2001). Serial Evaluation of the SOFA Score to Predict Outcome in Critically Ill Patients. Jama 286(14), 1754–1758.

Forman, H. J., Augusto, O., Brigelius-Flohe, R., Dennery, Ph. A., Kalyanaraman, B., Ischiropoulos, H., Mann, G. E., Radi, R., Roberts, L. J., & Vina, J. (2015). Even Free Radicals Should Follow Some Rules. Free Radical Biology and Medicine 78, 233–235.

Gabrielyan, N. I., Savostyanova, O. A., Gorskaya, Ye. M., & Poptsov, V. I. (2011). The Significance of Postoperative Measurement of the Middle Molecular Weight as a Predictor of Suppurative Septic Infections in Cardiac Surgery Patients. Epidemiology and Infectious Diseases, 1, 20–25.

Halliwell, B., & Chirico, S. (1993). Lipid Peroxidation. The American Journal of Clinical Nutrition, 57(5), 715–724.

Herath, H. M., & Kulatunga, A. (2016). Acute Pancreatitis Complicated with Deep Vein Thrombosis and Pulmonary Embolism. Journal of Medical Case Reports, 10, 253-267.

Kaliev, A. A., Zhakiev, B. S., Eleulov, G. A., & Konakbaeva, N. K. (2013). Concomitant Use of Intravenous Ozone Therapy and Small Doses of Direct Current in the Integrated Treatment of Patient with Sterile Pancreatic Necrosis. Proceedings of the Russian Academy of Medical Sciences/Russian Academy of Medical Sciences, 1(2), 16–18.

Karakayali, F. Y. (2014). Surgical and Interventional Management of Complications Caused by Acute Pancreatitis. World Journal of Gastroenterology,  20(37), 134-142.

Knaus, W. A, Draper, E. A., Wagner, D. P., & Zimmerman, J. E. (1985). A Severity of Disease Classification System. Critical Care Medicine, 13(10), 818–829.

Knaus, W. A., Wagner, D. P., Draper, E. A., Zimmerman, J. E., Bergner, M., Bastos, P. G., Sirio, C. A, Murphy, D. J., Lotring, T., & Damiano, A. (1991). Prognostic System. Risk Prediction of Hospital Mortality for Critically Hospitalized Adults. Chest Journal, 100(6), 1619–1636.

Lankisch, P. G., Assmus, C., Maisonneuve, P., & Lowenfels, A. B. (2002). A Study in a Defined German Population. Pancreatology, 2(5), 469–477.

Larvin, M. & Mcmahon M. J. (1989). Score for Assessment and Monitoring of Acute Pancreatitis. The Lancet, 334, 201–205.

Li, Q., Bai Z., Xueyan Z., Chendlin P., Wenpeng C., Wang Y., Jing S., Wenguo C., & Wenpeng, M. (2016). Treatment of Necrotizing Acute Pancreatitis with Peritoneal Lavage and Dialysis by a New Simpli Fi Ed Technique Insert Catheters. Medicine, 95(23), 214–226.

Lindkvist, B., Appelros, S., Manjer, J., & Borgström, A. (2004). Trends in Incidence of Acute Pancreatitis in a Swedish Population: Is There Really an Increase? Clinical Gastroenterology and Hepatology 2(9), 831–837.

Maher, M. M., Lucey, B. C., Gervais, D. A., & Mueller, P. R. (2004). Acute Pancreatitis: The Role of Imaging and Interventional Radiology. Cardiovascular and Interventional Radiology, 27, 208–225.

Mikolasevic, I., Milic, S., Orli,c L., Poropat, G., Jakopcic, I., Franjic, N., Klanac, A., Kristo, N., & Stimac, D. (2016). European Journal of Internal Medicine Metabolic Syndrome and Acute Pancreatitis. European Journal of Internal Medicine., 12(2), 245-252.

Nikolskaya, V. A., Danilchenko, Yu. D., & Memetova Z. N. (2013). The Biochemical Aspect of the Role of Middle Molecular Mass in the Organism. Scientific Notes of the Community of the V.I. Vernadsky Tavrida National University, 5, 145-152.

Nydegger, A., Heine, R. G., Ranuh, R., Gegati-levy, R., Crameri, J., & Oliver, M. R. (2007). Changing Incidence of Acute Pancreatitis. Gastroenterology 22: 1313–1316.

Ostrovskiĭ, V. K., Alimov, R. R., Mashchenko, A. V., Semenova, O. P., & Kurapova, M. I. (2003). Normal Parameters of Leukocyte Index of Intoxication. Clinical Laboratory Diagnostics, 1, 45–46.

Pankhurst, Q. A., Connolly, J., Jones, S. K., & Dobson J. (2003). Applications of Magnetic Nanoparticles in Biomedicine. Journal of Physics, 36, 167–181.

Papachristou, G. I., Muddana, V., Yadav, D., Connell, M. O., & Sanders, M. K. (2010). Comparison of BISAP , Ranson’s, APACHE-II , and CTSI Scores in Predicting Organ Failure, Complications, and Mortality in Acute Pancreatitis. The American Journal of Gastroenterology 105, 435–441.

Pereslegina, I. A. (1989). The Activity of Antioxidant Enzymes in the Saliva of Healthy Children. Laboratory Studies, 11, 20–23.

Ranson, J. H. (1979). The Timing of Biliary Surgery in Acute Pancreatitis. Annals of Surgery 189(5), 654.

Schwartz, J., Winters, J. L., Padmanabhan, A., Balogun, R. A., Delaney, M., Linenberger, M. L., Szczepiorkowski, Z. M., Williams, M. E., Wu Yanyun, & Shaz, B. H. (2013). Guidelines on the Use of Therapeutic Apheresis in Clinical Practice-Evidence‐Based Approach from the Writing Committee of the American Society for Apheresis. Journal of Clinical Apheresis 28(3), 145–284.

Sheĭko, V. D., & Oganezian A. H. (2013). The Optimization of Surgical Tactics in Local Accumulations of Liquid in Patients with Severe Acute Pancreatitis. Ministry of Healthcare of Ukraine, Scientific Community of Surgeons of Ukraine, 12, 22–24.

Spanier, B. W., Dijkgraaf, M. G., & Bruno M. J. (2008). Epidemiology, Aetiology and Outcome of Acute and Chronic Pancreatitis. Best Practice & Research Clinical Gastroenterology 22(1), 45–63.

Tenner, S., Baillie, J., DeWitt, J., & Vege, S. S. (2013). American College of Gastroenterology Guideline. Am J Gastroenterol, 108(9), 140–152.

Tinto, A., Lloyd D. A. J., Kang, J.-Y., Majeed, A., Ellis, C., Williamson, R. C., & Maxwell, J. D. (2002). Acute and Chronic Pancreatitis-Diseases on the Rise. Alimentary Pharmacology & Therapeutics, 16(12), 97–105.

Tokar, J. L., Barth, B. A., Banerjee, S., Chauhan, Sh. S., Gottlieb, K. T, Konda, V., Maple, J. T., Murad, F. M., Pfau, P. R., & Pleskow, D. K. (2013). Electrosurgical Generators. Gastrointestinal Endoscopy, 78(2), 197–208.

VanSonnenberg, E., Wittich, G. R., Casola, G., Brannigan, T. C., Karnel, F., Stabile, B. E., Varney, R. R., & Christensen, R. R. (1989). Percutaneous Drainage of Infected and Noninfected Pancreatic Pseudocysts. Radiology, 170(3), 757–761.

Vinokurov, M. M., Savel’ev, V. V., & Ammosov, V. G. (2008). Advantages and Disadvantages of Various Surgical Tactics in Treatment of Infected Pancreatic Necrosis. Surgery, 11, 23–26.

Volchegorsky, I. A., Dolgushin, I. I., Kolesnikov, O. L., & Tseylikman, V. E. (2000). Experimental Modeling and Laboratory Assessment of the Organism's Adaptation Responses. Chelyabinsk: Mir, 167 p.

Voskanyan, S. E., Kotenko, K. V., Korsakov, I. N., & Naydenov, E. V. (2013). Prediction of the Acute Pancreatitis after Surgery on the Pancreas. Experimental & Clinical Gastroenterology, 9, 61–68.

Wu, B. U., Johannes, R. S., Xiaowu S., Ying T., Conwell, D. L, & Banks, P. A. (2008). The Early Prediction of Mortality in Acute Pancreatitis. Gut 57(12), 1698–1703.

Yousaf, M., McCallion, K., & Diamond, T. (2003). Management of Severe Acute Pancreatitis. British Journal of Surgery 90(4), 407–420.

Zerem, E. (2014). Treatment of Severe Acute Pancreatitis and Its Complications. World Journal of Gastroenterology 20(38), 13879–13892.

Barnett, H. (2014). Constitutional & Administrative Law. London: Routledge, 880 p.

Clayton, C. W. (2015). The Politics of Justice: Attorney General and the Making of Government Legal Policy. London: Routledge, 320 p.

Dunn, W. N. (2015). Public policy analysis. London: Routledge, 480 p.

Harel, A. (2015). Why law matters: A reply to Lorenzo Zucca. International Journal of Constitutional Law, 13(1), 311-318.

Henderson, J. (2015). Developments in Russia. European Public Law, 21(2), 229-238

Kondratieva, М. А. (2010). Constitutional law and politics in the Russian Federation. Moscow: AST, 833 p.

Kozlova, E. I., & Kutafin, O. E. (2014). Constitutional law of Russia. Moscow: Nauka, 230 p.

Malko, A. V. (2010). Constitutional politics as a particular kind of legal policy. Constitutional and municipal law, 4, 4.

Malko, A. V. (2001). Constitutional and legal policy of modern Russia: problems and solutions. Law and politics, 6, 11.

Osipian, A. L. (2014). Putin’s Russia: Constitutional Order and Arbitrary Arrangements. European Journal of Sociology, 55(3), 482-485.

Dunaev, A. V. (2005). Legal policy of constituent entities in the Russian Federation: problems of formation and implementation. Legal policy and legal life, 4, 183-190;

Averianova, Y. I. (1993).  Encyclopaedic dictionary. Moscow: Nauka, 251 p.

Matuzov, N. I. (2003) Legal policy: essence, concept and reality. Moscow: AST, 77 p

Rybakov, O. Y., & Priahina, Т. М. (2003). Constitutional and legal policy. Russian legal policy. Moscow: Academia, 235 p.

Sabatier, P. A., Weible, C. (2014). Theories of the policy process. London: Westview Press, 432 p.

Sakwa, R. (2013). Power and policy in Putin’s Russia. London: Routledge, 262 p.

Sankari, S. (2016). The many constitutions of Europe. London: Routledge, 298 p.

Zhovnirchyk, Y. F. (2016). Constitutional and Legal Framework Construction of Public Policy Able Territorial Communities .Management, 15(1), 147-161.

Africa N. (2015). Russia and Eurasia. Strategic Survey, 115(1), 112-118.

Agreement on the Application of Sanitary and Phytosanitary Measures of WTO, adopted in April, 15, 1994. (2007). The Legal Texts. The Results of the Uruguay Round of Multilateral Trade Negotiations, 13, 59-72.

Ayanbayev, Y. S., Sairambayeva, Z. T. & Aidarbayev, S. Z. (2015). Sanitary and Veterinary Regulations of Pesticides Use: Unternational Law and Its Significance for the Republic of Kazakhstan. Asian Social Science, 11(19), 31-35.

Black, R. & Kireeva, I. (2014). “Sanitary and veterinary hygiene requirements for imports of  fish  and  fishery  products  into  Russia — the  tensions  between regional  integration  and globalization. ERA Forum, 15(4), 495-518.

Constitution of the Republic of Kazakhstan (1995). Direct access: http://www.constitution.-kz/english/

Delcour, L. & Wolczuk, K. (2015). The EU’s Unexpected ‘Ideal Neighbour’? The Perplexing Case of Armenia’s Europeanisation. Journal of European Integration, 37(4), 491-507.

Dergousoff, D. (2015). Perceptions about implications of the Eurasian Economic Union on food security in Kyrgyzstan. Direct access: https://www.academia.edu/20566676/Perceptions_-about_Implications_of_the_Eurasian_Economic_Union_on_Food_Security_in_Kyrgyzstan.

Dumitru, A. (2015). Whither development? The effects of the Eurasian Union on the Central Asian Republics. Romanian Journal of Society & Politics 10(2), 94-118.

Awad, I. (2008). The global economic crisis and migrant workers. International Labour Organization, 433612, 27-31.

Basic Law for the Federal Republic of Germany (1949). German: Federal Law Gazette II, 885 p.

Beloko N. (2006). Labour Code of the Republic of Bulgaria, 26(6), 24-29.

Berg, J. (2015). Labour Markets, Institutions and Inequality: Building Just Societies in the 21st Century. London: Edward Elgar Publishing, 37 p.

Boston, S., & O'Grady, F. (2015). Women workers and the trade unions. London: Lawrence & Wishart, 466 p.

Dufresne, A. (2015). The trade union response to the European economic governance regime. European Review of Labour and Research, 21(2), 141-156.

Galgóczi, B., & Leschke, J. (2016). EU labour migration in troubled times: skills mismatch, return and policy responses. London: Routledge, 308 p.

Geary, J. (2016). Economic crisis, austerity and trade union responses: The Irish case in comparative perspective. European Journal of Industrial Relations, 22(2), 131-147.

Keune, M. (2015). Trade unions and young workers in seven EU countries. Direct access: https://sase.confex.com/sase/2015am/webprogram/Paper2837.html

Labour Code of the Russian Federation, (2006). Russia: Zákoník práce, 2017 p.

Law of the Republic of Moldova, 1129-XIV. (2000). Chisinau: Federal Law Gazette, 366 p.

Law of Ukraine “On Trade Unions, their Rights and Guarantees of Their Activities”. (1999). Human Rights in Patient Care: Ukraine, 301-352.

MacLean, A. (2007). The Constitution of Belgium, 71 p.

Marino, S., Penninx, R., & Roosblad, J. (2015). Trade unions, immigration and immigrants in Europe revisited: Unions’ attitudes and actions under new conditions. Comparative Migration Studies, 3(1), 17-26.

Nohlen, D., & Stöver, P.  (1921). The Constitution of Liechtenstein. European Union. Elections in Europe: A data handbook, 1156 p.

Penninx, R., & Roosblad, J. (2000). Trade unions, immigration, and immigrants in Europe, 1960-1993. Oxford: Berghahn Books, 256 p.

The Austrian Federal Constitution, (1920). Austria: Elections in Europe: A data handbook 112 p.

The Constitution of Luxembourg, (1868). Luxembourg, forum (in French) (286), 30-33.

The Federal Constitution of the Swiss Confederation. (1999). Federal Council Decree of 11 Aug. Sweden, 101-187.

The Law On Trade Unions of the Republic of Lithuania, (1990). The Republic of Lithuania, 8 (98), 1-11.

Universal Declaration of Human Rights, (1948). Dominican Republic: United Nations.

Azmi, D. M. (2009). The legal value and correlation of the notions “process” and “procedure”. Advocate, 12, 13-20.

Berman, D. M. & Haneman, V. J. (2014). Making Tax Law. Durham: Carolina Academic Press, 325 p.

Demin, A. V. (2010a). Procedural norms of the tax law: notion and specificity. Taxes and taxation, 11, 66-70.

Demin, A. V. (2010b). Tax process and tax procedures: the searches of compromise. Taxes, 3, 6-9.

Ehrke-Rabel, T. (2014). Das schlaue Lernsystem Lehrbuch. Elements Steuerrecht, 6, 14-25.

Fujii, M. (2016). The Japanese tax system. London: Routledge, 91 p.

Harris, P. (2013). Corporate tax law: Structure, policy and practice. Cambridge: Cambridge University Press, 256p.

Heinrich, J. (2013). Österreichisches Steuerrecht. Uppsala: Verlag Osterreich, 363 p.

Hogg, P., Magee, J. & Li, J. (2013). Principles of Canadian Income Tax Law. Toronto: Carswell, 233 p.

Hudiakov, A. & Brodskiy, G. (2002). The theory of taxation. Almaty: Kazakh University, 364 p.

Kashanina, T. & Kashanin, A. (2009). The Russian law. Moscow: Norma, 422 p.

Kerimov, D. (2000). Legislative technique. Moscow: Norma, 366 p.

Krokhina, Y. (2012). Tax law. Moscow: Unity-Dana, 286 p.

Krokhina, Yu. (2004). Tax law. Moscow: Norma, 342 p.

Kucheriavenko, N. (2009). Tax law course. Kharkov: Statut, 77 p.

Kucherov, I. (2012). Legal signs of money obligations and their difference from money obligations. Financial law, 1, 12 – 18.

Pahlsson, R. (2001). Inledning till skatteratten. Andra upplagan. Uppsala: Iustus Forlag, 216 p.

Parygin, V. & Tedeev, A. (2011). Tax law. Voronezh: MODEK, 266 p.

Qiu, D. (2014). Interpretation of Tax Law in China: Moving Towards the Rule of Law? Hong Kong Law Journal, 2, 34-46.

Rembar, C. (2015). The law of the land: The evolution of our legal system. New-York: Open Road Media, 363 p.

Romashov, R. (2005). The Theory of State and Law. St. Petersburg: Piter, 352 p.

Shaviro, D. (2014). The Economics of Tax Law. Oxford: Oxford Handbook of Law and Economics, 353 p.

Staroverova, O. & Eriashvili, N. (2004). Rule and law. Moscow: Unity-Dana, 333 p.

Tavis, A. (2015). Tax and Social Justice: Perspectives of a Brunswick Public Service Fellow. Tax Law, 68, 455.

Unger, P. & Vock, M. (2015). Casebook Steuerrecht. Uppsala: Verlag Osterreich, 175 p.

Vinnitskiy, D. (2015). Russian tax law. St. Petersburg: Juridichesky Center–Press, 472 p.

Adorjan, M., & Ricciardelli, R. (2016). Engaging with Ethics in International Criminological Research. London: Routledge, 422 p.

Bäck, T. (2015). Police Students' Values of Competence Related to a Professional Career. Working and Learning in Times of Uncertainty. Sense Publishers, 89-101.

De Schrijver, A., & Maesschalck, J. (2015). The development of moral reasoning skills in police recruits. Policing: An International Journal of Police Strategies & Management, 38(1), 102-116.

Derkach, A. A. (1996). The Workbook of a Psychological Practitioner: The Technology of Effective Professional Activity. Moscow: Red Square, 400 p.

Fenwick, T. (2015). Perspectives on Policing: Critical Challenges for Policing Professionalism & Education. Scottish Institute for Policing Research, 4, 10-16.

Goriaynov, K. K., Ovchinsky, V. S. & Shumilov, A. Yu. (2001). Investigative Work. Moscow: INFRA-M, 794 p.

Grebelsky, D. V. (1988). Some Questions Regarding the Improvement of the "Investigative Work of Internal Affairs Agencies" Course. Ministry of Internal Affairs of the USSR High School, 16, 61-65.

Jones, M. (2015). Creating the "thinking police officer": Exploring Motivations and Professional Impact of Part-time Higher Education. Policing, 3, 39-45.

Klimentieva, O. S. (2015). Conflictological Competence as a Constituent of Professionalism of Prospective Law-Enforcement Officers. Pedagogy and Psychology, 51, 269-276.

Lawton, A., van der Wal, Z., & Huberts, L. (2015). Ethics in public policy and management. London: Routledge, 236 p.

Lindberg, O., & Rantatalo, O. (2014). Competence in professional practice. Human relations, 15, 18-23.

May, L. (1996). The Socially Responsive Self. Social theory and professional ethics. Chicago, University of Chicago Press, 328 p.

Meine, M. F., & Dunn, T. P. (2013). The search for ethical competency. Public Integrity 15(2), 149-166.

Nakayama, T. K., & Martin, J. N. (2014). Chapter five ethical issues in intercultural communication competence. Conceptualization and its development in cultural contexts and interactions, 12, 97-102.

O'Leary, C. (2009), An empirical analysis of the positive impact of ethics teaching on accounting students. Accounting Education: An International Journal, 18(5), 505-520.

Prygunov, P. Ya. (2000). Psychological Support of Special Operations. Role Behavior: A Study Guide. Moscow: European University Publishing House, 303 p.

Syromyatnikov, I. V. (2005). Psycho-diagnostics. Yekaterinburg: Business Book, 640 p.

Van Montfort, A., Beck, L., & Twijnstra, A. (2013). Can integrity be taught in public organizaitons? Public Integrity, 15(2), 117-132.

Vanebo, J. O., Bjørkelo, B., & Aaserud, T. (2015). Police leadership development: Intentions and critical success-factors. International Public Administration Review, 13(4), 11-26.

Weber, J., & Glyptis, S. (2000). Measuring the impact of a business ethics course and community service experience on students' values and opinions. Teaching Business Ethics, 4(4), 341-358.

West, J. P., & Berman, E. M. (2015). Ethics Management and Training. Public Personnel Management, 3(2), 213-220.

Alekseev, M. N., Arkhangelov, A. A. & Ivanova, N. M. (1992). Laptev and East Siberian seas Cenozoic, in Paleogeographic Atlas of the Shelf Regions of Eurasia for the Mesozoic and Cenozoic. Moscow: Geol. Inst. Russ. Acad. of Sci., 226 p.

Alexanderson, H., Backman, J., Cronin, T. M., Funder, S., Ingólfsson, Ó., Jakobsson, M., Landvik, J. Y., Löwemark, L., Mangerud, J., März, C., Möller, P., O’Regan, M., Spielhagen, R. F. (2014). An Arctic perspective on dating Mid-Late Pleistocene environmental history. Quat. Sci. Rev. 92, 9–31.

Andreassen, K., Winsborrow, M. C., Bjarnadottir, L. R. & Rüther, D. C. (2013). Landform assemblage from the collapse of the Bjørnøyrenna palaeo-ice stream, northern Barents Sea. Quat. Sci. Rev. 23, 58–73.

Astakhov, V. I. (2013). Pleistocene glaciations of northern Russia - a modern view. Boreas 42, 1–24.

Avetisov, G. P. (1993). Some Aspects of Lithospheric Dynamics of Laptev Sea. Physics of the Solid Earth, 29, 402–412.

Bjarnadóttir, L. R., Rüther, D. C., Winsborrow, M. C. & Andreassen, K. (2013). Grounding-line dynamics during the last deglaciation of Kveithola, W Barents Sea, as revealed by seabed geomorphology and shallow seismic stratigraphy. Borea, 42, 84–107.

Cronin, T. M., Dwyer, G. S., Farmer, J., Bauch, H. A., Spielhagen, R. F., Jakobsson, M., Nilsson, J., Briggs, W. M. & Stepanova, A. (2012). Deep Arctic Ocean warming during the last glacial cycle. Nature Geoscience, 5, 631–634.

Dobretsov, N. L. (2005). Geologicаl implicаtions of the thermochemicаl plume model. Russian Geology and Geophysics, 9, 870–890.

Dove, D., Polyak, L. & Coakley, B. (2014). Widespread, multi-source glacial erosion on the Chukchi margin, Arctic Ocean. Quaternary Science Reviews, 92, 112–122.

Drachev, S. S. & Saunders, A. (2006). The early Cretaceous Arctic LIP: Its geodynamic setting and implications for Canada Basin opening, in: Scott, R.A., Thurston, D.K. (Eds.), Proceedings of the Fourth International Conference on Arctic Margins. OCS Study MMS, 216–223.

Drаchev, S.S. (2002). On the tectonics of the Lаptev Seа shelf bed. Geotectonics 6, 55–70.

Fritz, M., Wetterich, S., Schirrmeister, L., Meyer, H., Lantuit, H., Preusser, F. & Pollard, W.H. (2012). Eastern Beringia and beyond. Direct access: http://dx.doi.org/10.1016/j.palaeo-.2011.12.015: hdl:10013/epic.38743

Gusev, E. A., Zinchenko, A. G., Bondarenko, C. A., Anikin, N. Y., Derevjanko, L. G., Maksimov, F. E., Kuznetsov, V. Y., Levchenko, S. B., Zherebtsov, I. E. & Popov, V. V. (2012). New Data on the Topography and Quaternary Deposits of the Outer Shelf, East Siberian Sea, Geology and Geoecology of the Eurazian Continental Margin. Moscow: GEOS, 332 p.

Ingólfsson, Ó. & Landvik, J. Y. (2013). The Svalbard–Barents Sea ice-sheet. Historical, current and future perspectives. Quaternary Science Reviews, 64, 33–60.

Kos’ko, M. & Trufanov, G. (2002). Middle Cretaceous to Eopleistocene Sequences on the New Siberian Islands: an approach to interpret offshore seismic. Marine and Petroleum Geology, 19, 901–919.

Lakeman, T. R. & England, J. H. (2013). Late Wisconsinan glaciation and postglacial relative sea-level change on western Banks Island, Canadian Arctic Archipelago. Quaternary Science Reviews, 80, 99–112.

Lakeman, T. R. & England, J. H., (2012). Paleoglaciological insights from the age and morphology of the Jesse moraine belt, western Canadian Arctic. Quaternary Science Reviews, 47, 82–100.

Landvik, J. Y., Alexanderson, H., Henriksen, M. & Ingolfsson, O. (2013). Resolving glacial phases in a coastal ice sheet marginal area, western Svalbard. Quaternary Science Reviews, 42, 56–67.

Leonov M. G., Bаluev А. S., Kuz’michev А. B., Leonov Y. G.  (2007). The tectonics of the Russiаn Аrctic shelf in the studies of the RАS Geologicаl Institute. Proceedings of the Internаtionаl Scientific Conference. Intercontаct Science, 352 p.

Löwemark, L., O’Regan, M., Hanebuth, T. J. & Jakobsson, M. (2012). Late Quaternary spatial and temporal variability in Arctic deep-sea bioturbation and its relation to Mn cycles. Palaeogeogr. Palaeoclimatol. Palaeoecol, 365-366.

Minakov, A., Faleide, J. I., Glebovsky, V. Y. & Mjelde, R. (2012). Structure and evolution of the northern Barents-Kara Sea continental margin from integrated analysis of potential fields, bathymetry and sparse seismic data. Geophysical Journal International, 188, 79–102.

Niessen, F., Hong, J.K., Hegewald, A., Matthiessen, J., Stein, R., Kim, H., Kim, S., Jensen, L., Jokat, W., Nam, S. I. & Kang, S. H. (2013). Repeated Pleistocene glaciation of the East Siberian continental margin. Nature Geoscience, 6, 842–846.

Noormets, R., Hogan, K., Austin, W.,  et al. (2012). Submarine glacial landform assemblages on the outer continental shelf north of Nordaustlandet, Svalbard. The 6th Arctic Paleoclimate and Its Extremes Meeting. Oululanka Research Station, Oulu, 70 p.

Petrovskаyа, N. А., Trishkinа, S. V. & Sаvishkinа, M. А. (2008). The Mаin Feаtures of the Geologicаl Structure of the Russiаn Chukchi Seа Sector. Oil and Gas Geology, 6, 20–28.

Anon, A. (2013). Ethical Principles for Medical Research Involving Human Subjects. World Medical Assotiation Declaration of Helsinki, 310(20), 206-208.

Cai, M. M., Smith, E. R. & Holt, S. G. (2015). The Role of Fetuin-A in Mineral Trafficking and Deposition. BoneKEy reports, 4, 672.

Combes, C. & Rey, C. (2002). Adsorption of Proteins and Calcium Phosphate Materials Bioactivity. Biomaterials, 23(13), 2817–23.

Dautova, Y. (2014). Fetuin-A and albumin alter cytotoxic effects of calcium phosphate nanoparticles on human vascular smooth muscle cells. PloS one, 9(5), 554-565.

Demer, L. L. & Tintut, Y. (2008). Vascular Calcification: Pathobiology of a Multifaceted Disease. Circulation, 117(22), 2938–2948.

Egan, K. P. (2011). Role for Circulating Osteogenic Precursor Cells in Aortic Valvular Disease. Arteriosclerosis, thrombosis, and vascular biology, 31(12), 2965–2971.

Giachelli, C. M. (1999). Ectopic calcification: Gathering Hard Facts About Soft Tissue Mineralization. The American Journal of Pathology, 154(3), 671–5.

Golub, E. E. (2011). Biomineralization and Matrix Vesicles in Biology and Pathology. Seminars in Immunopathology, 33(5), 409–17.

Jahnen-Dechent, W. (2011). Fetuin-A Regulation of Calcified Matrix Metabolism. Circulation Research, 108(12), 494–509.

Le Geros, R. Z. (2001). Formation and Transformation of Calcium Phosphates: Relevance to Vascular Calcification. Zeitschrift für Kardiologie, 90(3), 116–24.

Leopold, J. A. (2012). Cellular Mechanisms of Aortic Valve Calcification. Circulation. Cardiovascular interventions, 5(4), 605–614.

London, G. M. (2013). Mechanisms of Arterial Calcifications and Consequences for Cardiovascular Function. Kidney International Supplements, 3(5), 442–445.

Miller, J. D., Weiss, R. M. & Heistad, D. D. (2011). Calcific Aortic Valve Stenosis: Methods, Models, and Mechanisms. Circulation Research, 108(11), 1392–1412.

Miller, V. M. (2004). Evidence of Nanobacterial-Like Structures in Calcified Human Arteries and Cardiac Valves. American Journal of Physiology. Heart and Circulatory Physiology, 287(3), 1115–1124.

Neven, E. (2011). Cell Biological and Physicochemical Aspects of Arterial Calcification. Kidney International, 79(11), 1166–1177.

New, S. E. & Aikawa, E. (2013). Role of Extracellular Vesicles in de Novo Mineralization: an Additional Novel Mechanism of Cardiovascular Calcification. Arteriosclerosis, Thrombosis, and Vascular Biology, 33(8), 1753–1758.

Raoult, D. (2008). Nanobacteria are Mineralo Fetuin Complexes. Plos Pathogens, 4(2), 41-53.

Reynolds, J. L. (2004). Human Vascular Smooth Muscle Cells Undergo Vesicle-Mediated Calcification in Response to Changes in Extracellular Calcium and Phosphate Concentrations. Journal of the American Society of Nephrology, 15(11), 2857–2867.

Sage, A. P. (2011). Hyperphosphatemia-Induced Nanocrystals Upregulate the Expression of Bone Morphogenetic Protein-2 and Osteopontin Genes in Mouse Smooth Muscle Cells in Vitro. Kidney International, 79(4), 414–422.

Schlieper, G. (2011). A Red Herring in Vascular Calcification: “Nanobacteria” are Protein-Mineral Complexes Involved in Biomineralization. European Renal Association, 26(11), 3436–3439.

Smith, E.R. (2013). Serum Fetuin-A Concentration and Fetuin-A-Containing Calciprotein Particles in Patients With Chronic Inflammatory Disease and Renal Failure. Nephrology, 18(3), 215–221.

Thompson, B. & Towler, D. A. (2012). Arterial Calcification and Bone Physiology. Endocrinology, 8(9), 529–43.

Titov, A. & Larionov, P. 2007. Bone-like Hydroxyapatite Formation in Human Blood. Calcified Tissue International, 80, 58.

Titov, A. (2004). Hydroxyapatite Formation in Human Blood. Sao-Paulo: ICAM-BR, 362 p.

Titov, A., Larionov, P. & Shchukin, V. (2000). Possible formation of hydroxyapatite in blood. Report of Biochemistry, 7(2), 124-132.

Wu, C. Y. (2009). Fetuin-Albumin-Mineral Complexes Resembling Serum Calcium Granules and Putative Nanobacteria. PloS one, 4(11), 805-816.

Yarbrough, D. K. (2010). Specific Binding and Mineralization of Calcified Surfaces By Small Peptides. Calcified Tissue International, 86(1), 58–66.

Yiu, A. J. (2015). Vascular Calcification and Stone Disease. Journal of Cardiovascular Development and Disease, 2(3), 141–164.

Akgün, N. (1994). Egzersiz ve spor fizyolojisi. Ege Üniversitesi Basımevi. 5. Baskı 2. Cilt İzmir.
Arınık, L., (1995). Esnekliğin geliştirilmesinde kullanılan farklı teknikler ve bunlardan p.n.f tekniğinin etkileri. Atletizm Bilim ve Teknoloji Dergisi. 20, 32-35-36. Ankara.
Ball, D. Burrows, C., & Sargeant, AJ. (1999). Human power output during repeated sprint cycle exercise: The influence of thermal stress. Eur J Appl Physiol Occup Physiol 79, 360-366 
Bayraktar B, & Kurtoğlu M. (2009) Sporda performans ve performans artırma yöntemleri. 22:(1),1-9.
Bergh, U., & Ekblom, B. (1979). Influence of muscle temperature on maximal muscle strength and power output in human skeletal muscles. Acta Physiol Scand 107: 33-37 
Chen, T., Tsai, J.H., Lee, N.Y., & Liang, M.T.C., (2013). Effect of short-term heat acclimation on endurance time and skin blood flow in trained athletes. Open Access J Sports Med. 4, 161–170.
Gözü, R.D., Liman, E., & Kan, İ., (1988). Thoraks ölçümleri ve solunum fonksiyonlarının antrenmanlarla değişimi. Spor Hekimliği Dergisi, 23 (1), 1-8.
Günay, M., Cicioğlu, İ., & Kara, E., (2006). Egzersize metabolik ve ısı adaptasyonu. Gazi Kitapevi, Ankara.
Johnson JM. (1998) Physical training and the control of skin blood flow. Med Sci Sports Exerc. 30(3):382–386.
Koz, M., Ersöz, G., & Gelir, E., (2003). Fizyoloji ders kitabı. Nobel Yayın Dağıtım. Ankara.
Lindberg, AS., Malm, C., Hammarström, D., Oksa, J., Tonkonogi, M. (2012). Maximal work capacity and performance depends warm-up procedure and environmental but not inspired air temperatures. Journal of Exercise Physiology., 15, 1.
Lorenzo, S., Halliwill, JR., Sawka, MN., & Minson, CT. (2010). Heat acclimation improves exercise performance. J Appl Physiol. 109(4),1140–1147.
Müller, MD., Seo, Y., Kim, CH., Ryan, EJ, Pollock, BS., Burns, KJ., & Glickman, EL. (2013). Cold habituation does not improve manual dexterity during rest and exercise in 5°C. International Biometeorol Journal. 2013 Feb 7.
Nımno, M. (2004). Exercise in cold. Journal of Sports Sciences, 22: 898-916
Oksa J, Rintamäki H, Rissanen S, Rytky S, Tolonen U, & Komi PV (2000). Stretch- and H-reflexes of the lower leg during whole body cooling and local warming. Aviat Space Environ Med 71,2: 156-161 
Polloc, ML., Gaesser, GA., & Butcher, JD. (1998) The recommended quantity and quality of exercise for developing and maintaining cardiorespiratory and muscular fitness and flexibility in healthy adults. Med Sci Sports Exerc 30: 975-991.
Radamaker, A. (1997) Human locomotory performance: effect of fatigue and temperature in relation to muscle fibre type variability. PhD Thesis, Vrije University Amsterdam. Pp 73-93
Racinais, S., Blonc, S., Jonville, S., & Hue, O. (2005) Time-of-day influences the environmental effects on muscle force and contractility. Med Sci Sports Exerc 37: 256-261 
Roberts, W.O., (2001). Cold-related injury in athletes and active people, Principles and Practice Of Primery Care Sports Medicine, Ed. By Carrett WE, Kirkandall DT, Philadelphia.
Roberts, W.O., (2005). Another viewpoint on exertional heatstroke. Phys. and Sportsmed. 33 (10): 42-49
Sevim, Y. (2002). Antrenman Bilgisi, Nobel Yayın Dağıtım. Ankara.
Smolander J, Kolari P, Korhonen O, & Ilmarinen R. (1987). Skin blood flow during incremental exercise in a thermoneutral and a hot dry environment. Eur J Appl Physiol Occup Physiol. 56(3), 273–280.
Ünal, M., (2002). Sıcak ve soğuk ortamda egzersiz. İstanbul Üniversitesi Tıp Fakültesi Mecmuası, İstanbul. 65(4), 206-210.
Zhao, J., Lorenzo, S., An, A., Feng, W., Lai, L. & Cui, S. (2013). Effects of heat and different humidity levels on aerobic and anaerobic exercise performance in athletes. Journal of Exercise Science & Fitness 11, 35-41
Zorba, E., Saygın, Ö. (2009). Fiziksel aktivite ve fiziksel uygunluk. İnceler Ofset Mat. Amb. San. Tic. Ltd. Şti. İstanbul.